Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 3107726..3108639 | Replicon | chromosome |
| Accession | NZ_CP119531 | ||
| Organism | Raoultella electrica strain Rd210413 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | P2G42_RS14920 | Protein ID | WP_131047981.1 |
| Coordinates | 3108166..3108639 (+) | Length | 158 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | P2G42_RS14915 | Protein ID | WP_141964473.1 |
| Coordinates | 3107726..3108169 (+) | Length | 148 a.a. |
Genomic Context
Location: 3105103..3105732 (630 bp)
Type: Others
Protein ID: WP_131047984.1
Type: Others
Protein ID: WP_131047984.1
Location: 3105924..3106400 (477 bp)
Type: Others
Protein ID: WP_141964474.1
Type: Others
Protein ID: WP_141964474.1
Location: 3107217..3107495 (279 bp)
Type: Others
Protein ID: WP_285237110.1
Type: Others
Protein ID: WP_285237110.1
Location: 3107726..3108169 (444 bp)
Type: Antitoxin
Protein ID: WP_141964473.1
Type: Antitoxin
Protein ID: WP_141964473.1
Location: 3108166..3108639 (474 bp)
Type: Toxin
Protein ID: WP_131047981.1
Type: Toxin
Protein ID: WP_131047981.1
Location: 3110676..3111242 (567 bp)
Type: Others
Protein ID: WP_015584190.1
Type: Others
Protein ID: WP_015584190.1
Location: 3111873..3111977 (105 bp)
Type: Others
Protein ID: Protein_2918
Type: Others
Protein ID: Protein_2918
Location: 3104102..3104995 (894 bp)
Type: Others
Protein ID: WP_100683647.1
Type: Others
Protein ID: WP_100683647.1
Location: 3108661..3109215 (555 bp)
Type: Others
Protein ID: WP_285237111.1
Type: Others
Protein ID: WP_285237111.1
Location: 3109225..3110096 (872 bp)
Type: Others
Protein ID: Protein_2916
Type: Others
Protein ID: Protein_2916
Location: 3112081..3112986 (906 bp)
Type: Others
Protein ID: WP_131047974.1
Type: Others
Protein ID: WP_131047974.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2G42_RS14880 (P2G42_14880) | 3104102..3104995 | - | 894 | WP_100683647.1 | LysR family transcriptional regulator | - |
| P2G42_RS14885 (P2G42_14885) | 3105103..3105732 | + | 630 | WP_131047984.1 | NAD(P)-binding domain-containing protein | - |
| P2G42_RS14890 (P2G42_14890) | 3105924..3106400 | + | 477 | WP_141964474.1 | acid resistance repetitive basic protein Asr | - |
| P2G42_RS14910 (P2G42_14910) | 3107217..3107495 | + | 279 | WP_285237110.1 | hypothetical protein | - |
| P2G42_RS14915 (P2G42_14915) | 3107726..3108169 | + | 444 | WP_141964473.1 | DUF2384 domain-containing protein | Antitoxin |
| P2G42_RS14920 (P2G42_14920) | 3108166..3108639 | + | 474 | WP_131047981.1 | RES domain-containing protein | Toxin |
| P2G42_RS14925 (P2G42_14925) | 3108661..3109215 | - | 555 | WP_285237111.1 | type I-F CRISPR-associated endoribonuclease Cas6/Csy4 | - |
| P2G42_RS14930 (P2G42_14930) | 3109225..3110096 | - | 872 | Protein_2916 | type I-F CRISPR-associated protein Csy3 | - |
| P2G42_RS14935 (P2G42_14935) | 3110676..3111242 | + | 567 | WP_015584190.1 | DJ-1/PfpI family protein | - |
| P2G42_RS14940 (P2G42_14940) | 3111873..3111977 | + | 105 | Protein_2918 | RES domain-containing protein | - |
| P2G42_RS14945 (P2G42_14945) | 3112081..3112986 | - | 906 | WP_131047974.1 | LysR substrate-binding domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17558.87 Da Isoelectric Point: 5.0692
>T274167 WP_131047981.1 NZ_CP119531:3108166-3108639 [Raoultella electrica]
MIFYRLVMGRYASEAWSGSGANQYGGRWNHKGHPAVYVSASISLASLEILVHVKKDAVLNQYQLFSIDIPDDQIEYLDQH
WLPEDWQENPAPVSTMDLGTGWLQATSALALVLPSCIIPYENNAILNPLHPAFHQALASVQQYPFVFDTRLAEKTAS
MIFYRLVMGRYASEAWSGSGANQYGGRWNHKGHPAVYVSASISLASLEILVHVKKDAVLNQYQLFSIDIPDDQIEYLDQH
WLPEDWQENPAPVSTMDLGTGWLQATSALALVLPSCIIPYENNAILNPLHPAFHQALASVQQYPFVFDTRLAEKTAS
Download Length: 474 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16453.70 Da Isoelectric Point: 5.7867
>AT274167 WP_141964473.1 NZ_CP119531:3107726-3108169 [Raoultella electrica]
MRTWVPEQKPADNALWRYAGLPANRGMRLIEFLNQGLPVSVLDNIHEWTEMSKADILRVTGINERNVARRKSAGRTLTPD
ESERVARFVRVLDAAVDYFGSKDEAWNWLQSPVRGLGNVAPVDLIATETGALEVTDLIGRLEHGVFA
MRTWVPEQKPADNALWRYAGLPANRGMRLIEFLNQGLPVSVLDNIHEWTEMSKADILRVTGINERNVARRKSAGRTLTPD
ESERVARFVRVLDAAVDYFGSKDEAWNWLQSPVRGLGNVAPVDLIATETGALEVTDLIGRLEHGVFA
Download Length: 444 bp