Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2733167..2733918 | Replicon | chromosome |
| Accession | NZ_CP119531 | ||
| Organism | Raoultella electrica strain Rd210413 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | P2G42_RS12860 | Protein ID | WP_141964594.1 |
| Coordinates | 2733167..2733649 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | - |
| Locus tag | P2G42_RS12865 | Protein ID | WP_100683705.1 |
| Coordinates | 2733640..2733918 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2G42_RS12830 (P2G42_12830) | 2728905..2729469 | - | 565 | Protein_2499 | SOS response-associated peptidase family protein | - |
| P2G42_RS12835 (P2G42_12835) | 2729730..2730233 | - | 504 | WP_131050351.1 | Imm70 family immunity protein | - |
| P2G42_RS12840 (P2G42_12840) | 2730539..2731030 | - | 492 | Protein_2501 | DUF637 domain-containing protein | - |
| P2G42_RS12845 (P2G42_12845) | 2731076..2731522 | + | 447 | Protein_2502 | helix-turn-helix domain-containing protein | - |
| P2G42_RS12850 (P2G42_12850) | 2731629..2732420 | + | 792 | WP_131050353.1 | tetratricopeptide repeat protein | - |
| P2G42_RS12855 (P2G42_12855) | 2732580..2733116 | - | 537 | WP_100683703.1 | dihydrofolate reductase family protein | - |
| P2G42_RS12860 (P2G42_12860) | 2733167..2733649 | - | 483 | WP_141964594.1 | GNAT family N-acetyltransferase | Toxin |
| P2G42_RS12865 (P2G42_12865) | 2733640..2733918 | - | 279 | WP_100683705.1 | DUF1778 domain-containing protein | Antitoxin |
| P2G42_RS12870 (P2G42_12870) | 2733998..2734600 | - | 603 | WP_160704955.1 | DJ-1/PfpI family protein | - |
| P2G42_RS12875 (P2G42_12875) | 2735161..2736186 | + | 1026 | WP_100683707.1 | amino acid ABC transporter substrate-binding protein | - |
| P2G42_RS12880 (P2G42_12880) | 2736257..2737435 | + | 1179 | WP_131050357.1 | amino acid ABC transporter permease | - |
| P2G42_RS12885 (P2G42_12885) | 2737451..2738551 | + | 1101 | WP_131050358.1 | amino acid ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaPLA-4A | - | 2703660..3034025 | 330365 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17681.43 Da Isoelectric Point: 9.1567
>T274166 WP_141964594.1 NZ_CP119531:c2733649-2733167 [Raoultella electrica]
MGMRPPESLTPEHDIAEFCCQDPGLNEWLKKKALKNHSTGISRVYVVCAGNTNRVIAYYCLSSGSVHRNTVPGTYRRNAP
ESVPVIVQGRLAVDVSWAGKGLGAALLKDAIYRTQNIAVQVGVRALLVHALNDEVRDFYTRFGFEPSIVNVLTLLFPIRL
MGMRPPESLTPEHDIAEFCCQDPGLNEWLKKKALKNHSTGISRVYVVCAGNTNRVIAYYCLSSGSVHRNTVPGTYRRNAP
ESVPVIVQGRLAVDVSWAGKGLGAALLKDAIYRTQNIAVQVGVRALLVHALNDEVRDFYTRFGFEPSIVNVLTLLFPIRL
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|