Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hipBA/HipA-HipB |
| Location | 2695762..2697365 | Replicon | chromosome |
| Accession | NZ_CP119531 | ||
| Organism | Raoultella electrica strain Rd210413 | ||
Toxin (Protein)
| Gene name | hipA | Uniprot ID | - |
| Locus tag | P2G42_RS12700 | Protein ID | WP_285236926.1 |
| Coordinates | 2696034..2697365 (+) | Length | 444 a.a. |
Antitoxin (Protein)
| Gene name | hipB | Uniprot ID | - |
| Locus tag | P2G42_RS12695 | Protein ID | WP_131049088.1 |
| Coordinates | 2695762..2696034 (+) | Length | 91 a.a. |
Genomic Context
Location: 2693219..2694460 (1242 bp)
Type: Others
Protein ID: WP_285236924.1
Type: Others
Protein ID: WP_285236924.1
Location: 2694580..2694996 (417 bp)
Type: Others
Protein ID: WP_160703369.1
Type: Others
Protein ID: WP_160703369.1
Location: 2695002..2695556 (555 bp)
Type: Others
Protein ID: WP_285236925.1
Type: Others
Protein ID: WP_285236925.1
Location: 2695762..2696034 (273 bp)
Type: Antitoxin
Protein ID: WP_131049088.1
Type: Antitoxin
Protein ID: WP_131049088.1
Location: 2696034..2697365 (1332 bp)
Type: Toxin
Protein ID: WP_285236926.1
Type: Toxin
Protein ID: WP_285236926.1
Location: 2699409..2700467 (1059 bp)
Type: Others
Protein ID: WP_206057711.1
Type: Others
Protein ID: WP_206057711.1
Location: 2700558..2701472 (915 bp)
Type: Others
Protein ID: WP_100684215.1
Type: Others
Protein ID: WP_100684215.1
Location: 2691250..2691978 (729 bp)
Type: Others
Protein ID: WP_285236923.1
Type: Others
Protein ID: WP_285236923.1
Location: 2691975..2692667 (693 bp)
Type: Others
Protein ID: WP_141964609.1
Type: Others
Protein ID: WP_141964609.1
Location: 2697298..2698704 (1407 bp)
Type: Others
Protein ID: WP_285238309.1
Type: Others
Protein ID: WP_285238309.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P2G42_RS12670 (P2G42_12670) | 2691250..2691978 | - | 729 | WP_285236923.1 | ABC transporter ATP-binding protein | - |
| P2G42_RS12675 (P2G42_12675) | 2691975..2692667 | - | 693 | WP_141964609.1 | TenA family protein | - |
| P2G42_RS12680 (P2G42_12680) | 2693219..2694460 | + | 1242 | WP_285236924.1 | sensor domain-containing diguanylate cyclase | - |
| P2G42_RS12685 (P2G42_12685) | 2694580..2694996 | + | 417 | WP_160703369.1 | hypothetical protein | - |
| P2G42_RS12690 (P2G42_12690) | 2695002..2695556 | + | 555 | WP_285236925.1 | sigma-70 family RNA polymerase sigma factor | - |
| P2G42_RS12695 (P2G42_12695) | 2695762..2696034 | + | 273 | WP_131049088.1 | type II toxin-antitoxin system antitoxin HipB | Antitoxin |
| P2G42_RS12700 (P2G42_12700) | 2696034..2697365 | + | 1332 | WP_285236926.1 | type II toxin-antitoxin system HipA family toxin | Toxin |
| P2G42_RS12705 (P2G42_12705) | 2697298..2698704 | - | 1407 | WP_285238309.1 | glycoside hydrolase family 10 protein | - |
| P2G42_RS12710 (P2G42_12710) | 2699409..2700467 | + | 1059 | WP_206057711.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
| P2G42_RS12715 (P2G42_12715) | 2700558..2701472 | + | 915 | WP_100684215.1 | branched-chain amino acid ABC transporter permease LivH | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 444 a.a. Molecular weight: 49403.78 Da Isoelectric Point: 7.1616
>T274165 WP_285236926.1 NZ_CP119531:2696034-2697365 [Raoultella electrica]
MATLVTWMNNERVGELIKQANGAHLFRYEEAWMRNPRARPLSLSLPLQYGNITDEAVFNYFDNLLPDSPRVRDRIVKRYQ
ARSKQPFDLLAEIGRDSVGAVTLLPPGENAPRGALSWEPLDNHALDMLLTAYRSDIPLGMVNEHDDFRISVAGAQEKTAL
LKIGEQWCIPTGTTPTTHIIKLPIGEIKQPDAVLDLSESVDNEYLCLALARALGFAVPQASIIQTASTRALAVERFDRRW
AQEKTVLLRLPQEDLCQAFGIPSSVKYESDGGPGIRAIMAFLVGSSEALEDRYNFMKFMVFQWLIGATDGHAKNFSIYLQ
PGGSYRLTPFYDIISAFPLLGGKGLHLSDLKLSMSLKASKGRKTEIQTLYPRHFLATAKEVGFARPQMLEILRYFVDNVP
RAVDAVKGTLPPDFSQPVYEAITDRLLWVHSRLQNAMAASPAG
MATLVTWMNNERVGELIKQANGAHLFRYEEAWMRNPRARPLSLSLPLQYGNITDEAVFNYFDNLLPDSPRVRDRIVKRYQ
ARSKQPFDLLAEIGRDSVGAVTLLPPGENAPRGALSWEPLDNHALDMLLTAYRSDIPLGMVNEHDDFRISVAGAQEKTAL
LKIGEQWCIPTGTTPTTHIIKLPIGEIKQPDAVLDLSESVDNEYLCLALARALGFAVPQASIIQTASTRALAVERFDRRW
AQEKTVLLRLPQEDLCQAFGIPSSVKYESDGGPGIRAIMAFLVGSSEALEDRYNFMKFMVFQWLIGATDGHAKNFSIYLQ
PGGSYRLTPFYDIISAFPLLGGKGLHLSDLKLSMSLKASKGRKTEIQTLYPRHFLATAKEVGFARPQMLEILRYFVDNVP
RAVDAVKGTLPPDFSQPVYEAITDRLLWVHSRLQNAMAASPAG
Download Length: 1332 bp