Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1333195..1333814 | Replicon | chromosome |
Accession | NZ_CP119531 | ||
Organism | Raoultella electrica strain Rd210413 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A514EV16 |
Locus tag | P2G42_RS06255 | Protein ID | WP_004858783.1 |
Coordinates | 1333195..1333413 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A514EV88 |
Locus tag | P2G42_RS06260 | Protein ID | WP_004858785.1 |
Coordinates | 1333440..1333814 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2G42_RS06220 (P2G42_06220) | 1329266..1329526 | + | 261 | WP_004858777.1 | type B 50S ribosomal protein L31 | - |
P2G42_RS06225 (P2G42_06225) | 1329529..1329669 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
P2G42_RS06230 (P2G42_06230) | 1329666..1330376 | - | 711 | WP_100683167.1 | GNAT family protein | - |
P2G42_RS06235 (P2G42_06235) | 1330487..1331932 | + | 1446 | WP_285237917.1 | PLP-dependent aminotransferase family protein | - |
P2G42_RS06240 (P2G42_06240) | 1331907..1332377 | - | 471 | WP_100683169.1 | YlaC family protein | - |
P2G42_RS06245 (P2G42_06245) | 1332371..1332505 | + | 135 | WP_224742582.1 | hypothetical protein | - |
P2G42_RS06250 (P2G42_06250) | 1332477..1333043 | - | 567 | WP_100683170.1 | maltose O-acetyltransferase | - |
P2G42_RS06255 (P2G42_06255) | 1333195..1333413 | - | 219 | WP_004858783.1 | HHA domain-containing protein | Toxin |
P2G42_RS06260 (P2G42_06260) | 1333440..1333814 | - | 375 | WP_004858785.1 | Hha toxicity modulator TomB | Antitoxin |
P2G42_RS06265 (P2G42_06265) | 1334340..1337486 | - | 3147 | WP_131047523.1 | multidrug efflux RND transporter permease subunit AcrB | - |
P2G42_RS06270 (P2G42_06270) | 1337509..1338702 | - | 1194 | WP_100683172.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8570.90 Da Isoelectric Point: 7.9907
>T274164 WP_004858783.1 NZ_CP119531:c1333413-1333195 [Raoultella electrica]
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGEPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14411.19 Da Isoelectric Point: 4.8989
>AT274164 WP_004858785.1 NZ_CP119531:c1333814-1333440 [Raoultella electrica]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYAEDNKLIAQLDEYL
DDTFMLFSSYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A514EV88 |