Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 782436..783012 | Replicon | chromosome |
Accession | NZ_CP119531 | ||
Organism | Raoultella electrica strain Rd210413 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | P2G42_RS03665 | Protein ID | WP_131049471.1 |
Coordinates | 782436..782723 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | P2G42_RS03670 | Protein ID | WP_141965380.1 |
Coordinates | 782710..783012 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2G42_RS03650 (P2G42_03650) | 779886..780668 | - | 783 | WP_141965383.1 | NAD(P)H-dependent oxidoreductase | - |
P2G42_RS03655 (P2G42_03655) | 780756..781664 | + | 909 | WP_141965382.1 | LysR family transcriptional regulator | - |
P2G42_RS03660 (P2G42_03660) | 781658..782101 | + | 444 | WP_141965381.1 | FosA family fosfomycin resistance glutathione transferase | - |
P2G42_RS03665 (P2G42_03665) | 782436..782723 | + | 288 | WP_131049471.1 | BrnT family toxin | Toxin |
P2G42_RS03670 (P2G42_03670) | 782710..783012 | + | 303 | WP_141965380.1 | BrnA antitoxin family protein | Antitoxin |
P2G42_RS03675 (P2G42_03675) | 783153..784565 | - | 1413 | WP_285237810.1 | PLP-dependent aminotransferase family protein | - |
P2G42_RS03680 (P2G42_03680) | 784743..784907 | + | 165 | WP_100684675.1 | DUF1127 domain-containing protein | - |
P2G42_RS03685 (P2G42_03685) | 785506..785970 | + | 465 | WP_141965379.1 | MarR family transcriptional regulator | - |
P2G42_RS03690 (P2G42_03690) | 785974..787041 | + | 1068 | WP_141965378.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11135.61 Da Isoelectric Point: 8.5787
>T274163 WP_131049471.1 NZ_CP119531:782436-782723 [Raoultella electrica]
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYQNGEYRWQTLGLVHGIIVILVAHSVRFESGTEVIRIIS
ARKADKKERSRYEHG
MPMEFEWDANKAASNLRKHGIRFEEAVLVFDDPQHLSRQDRYQNGEYRWQTLGLVHGIIVILVAHSVRFESGTEVIRIIS
ARKADKKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|