Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 2662417..2663115 | Replicon | chromosome |
Accession | NZ_CP119528 | ||
Organism | Enterococcus faecalis strain 3143 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | A0A059N529 |
Locus tag | P0083_RS13365 | Protein ID | WP_002373917.1 |
Coordinates | 2662771..2663115 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | P0083_RS13360 | Protein ID | WP_002388206.1 |
Coordinates | 2662417..2662752 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0083_RS13305 (2657633) | 2657633..2658448 | - | 816 | WP_010706853.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
P0083_RS13310 (2658411) | 2658411..2659382 | - | 972 | WP_010706854.1 | RecT family recombinase | - |
P0083_RS13315 (2659475) | 2659475..2659831 | - | 357 | WP_010706855.1 | hypothetical protein | - |
P0083_RS13320 (2659834) | 2659834..2660058 | - | 225 | WP_267599538.1 | hypothetical protein | - |
P0083_RS13325 (2660055) | 2660055..2660354 | - | 300 | WP_010706856.1 | hypothetical protein | - |
P0083_RS13330 (2660441) | 2660441..2660857 | - | 417 | WP_002417286.1 | hypothetical protein | - |
P0083_RS13335 (2660858) | 2660858..2661028 | - | 171 | WP_010706857.1 | hypothetical protein | - |
P0083_RS13340 (2661063) | 2661063..2661332 | - | 270 | WP_002365131.1 | hypothetical protein | - |
P0083_RS13345 (2661350) | 2661350..2661529 | - | 180 | WP_229202013.1 | DUF2829 domain-containing protein | - |
P0083_RS13350 (2661592) | 2661592..2661930 | - | 339 | WP_010706859.1 | hypothetical protein | - |
P0083_RS13355 (2661943) | 2661943..2662125 | - | 183 | WP_002388205.1 | hypothetical protein | - |
P0083_RS13360 (2662417) | 2662417..2662752 | + | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P0083_RS13365 (2662771) | 2662771..2663115 | + | 345 | WP_002373917.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
P0083_RS13370 (2663144) | 2663144..2663542 | + | 399 | WP_010706860.1 | hypothetical protein | - |
P0083_RS13375 (2663560) | 2663560..2664291 | + | 732 | WP_010706861.1 | potassium channel family protein | - |
P0083_RS13380 (2664446) | 2664446..2665627 | + | 1182 | WP_002365138.1 | site-specific integrase | - |
P0083_RS13385 (2665730) | 2665730..2665879 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2631447..2665627 | 34180 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13594.61 Da Isoelectric Point: 5.6177
>T274144 WP_002373917.1 NZ_CP119528:2662771-2663115 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEIYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|