Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 2268883..2269484 Replicon chromosome
Accession NZ_CP119523
Organism Pasteurella multocida strain LXSS001

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P0Y37_RS10975 Protein ID WP_078819687.1
Coordinates 2268883..2269197 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag P0Y37_RS10980 Protein ID WP_078819686.1
Coordinates 2269194..2269484 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0Y37_RS10940 2264525..2265151 - 627 WP_078819688.1 Bro-N domain-containing protein -
P0Y37_RS10945 2265565..2266362 - 798 WP_032854018.1 hypothetical protein -
P0Y37_RS10950 2266449..2266712 - 264 WP_014391456.1 hypothetical protein -
P0Y37_RS10955 2266896..2267168 + 273 WP_014391457.1 hypothetical protein -
P0Y37_RS10960 2267161..2267349 - 189 WP_014391458.1 hypothetical protein -
P0Y37_RS10965 2267887..2268168 + 282 WP_193628061.1 hypothetical protein -
P0Y37_RS10970 2268421..2268621 - 201 WP_193628062.1 hypothetical protein -
P0Y37_RS10975 2268883..2269197 + 315 WP_078819687.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P0Y37_RS10980 2269194..2269484 + 291 WP_078819686.1 putative addiction module antidote protein Antitoxin
P0Y37_RS10985 2269510..2269914 - 405 WP_146024473.1 hypothetical protein -
P0Y37_RS10990 2269944..2271788 - 1845 WP_071523830.1 DEAD/DEAH box helicase family protein -
P0Y37_RS10995 2271999..2272676 - 678 WP_014390718.1 XRE family transcriptional regulator -
P0Y37_RS11000 2272800..2272997 + 198 WP_014390719.1 helix-turn-helix domain-containing protein -
P0Y37_RS11005 2273047..2273508 + 462 WP_078802159.1 hypothetical protein -
P0Y37_RS11010 2273569..2274252 + 684 WP_078802160.1 phage antirepressor KilAC domain-containing protein -
P0Y37_RS11015 2274249..2274464 + 216 WP_075271368.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2249096..2307151 58055


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-97)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11763.65 Da        Isoelectric Point: 9.5553

>T274141 WP_078819687.1 NZ_CP119523:2268883-2269197 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10574.22 Da        Isoelectric Point: 5.7134

>AT274141 WP_078819686.1 NZ_CP119523:2269194-2269484 [Pasteurella multocida]
MSKKVELKPFDIAEYLDSEEMIAAYLSEILETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSHGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References