Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2268883..2269484 | Replicon | chromosome |
| Accession | NZ_CP119523 | ||
| Organism | Pasteurella multocida strain LXSS001 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P0Y37_RS10975 | Protein ID | WP_078819687.1 |
| Coordinates | 2268883..2269197 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P0Y37_RS10980 | Protein ID | WP_078819686.1 |
| Coordinates | 2269194..2269484 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0Y37_RS10940 | 2264525..2265151 | - | 627 | WP_078819688.1 | Bro-N domain-containing protein | - |
| P0Y37_RS10945 | 2265565..2266362 | - | 798 | WP_032854018.1 | hypothetical protein | - |
| P0Y37_RS10950 | 2266449..2266712 | - | 264 | WP_014391456.1 | hypothetical protein | - |
| P0Y37_RS10955 | 2266896..2267168 | + | 273 | WP_014391457.1 | hypothetical protein | - |
| P0Y37_RS10960 | 2267161..2267349 | - | 189 | WP_014391458.1 | hypothetical protein | - |
| P0Y37_RS10965 | 2267887..2268168 | + | 282 | WP_193628061.1 | hypothetical protein | - |
| P0Y37_RS10970 | 2268421..2268621 | - | 201 | WP_193628062.1 | hypothetical protein | - |
| P0Y37_RS10975 | 2268883..2269197 | + | 315 | WP_078819687.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0Y37_RS10980 | 2269194..2269484 | + | 291 | WP_078819686.1 | putative addiction module antidote protein | Antitoxin |
| P0Y37_RS10985 | 2269510..2269914 | - | 405 | WP_146024473.1 | hypothetical protein | - |
| P0Y37_RS10990 | 2269944..2271788 | - | 1845 | WP_071523830.1 | DEAD/DEAH box helicase family protein | - |
| P0Y37_RS10995 | 2271999..2272676 | - | 678 | WP_014390718.1 | XRE family transcriptional regulator | - |
| P0Y37_RS11000 | 2272800..2272997 | + | 198 | WP_014390719.1 | helix-turn-helix domain-containing protein | - |
| P0Y37_RS11005 | 2273047..2273508 | + | 462 | WP_078802159.1 | hypothetical protein | - |
| P0Y37_RS11010 | 2273569..2274252 | + | 684 | WP_078802160.1 | phage antirepressor KilAC domain-containing protein | - |
| P0Y37_RS11015 | 2274249..2274464 | + | 216 | WP_075271368.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2249096..2307151 | 58055 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11763.65 Da Isoelectric Point: 9.5553
>T274141 WP_078819687.1 NZ_CP119523:2268883-2269197 [Pasteurella multocida]
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
MLDIIETTVFNKWLKELKDLSAKAAILARISRAKSGNFGDHKSVGDGLYEMRIMKGAGYRVYYAQYKDVTYLLICGGDKS
TQKADIAKAKALWEEIKQKEEINV
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|