Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 943712..944286 | Replicon | chromosome |
Accession | NZ_CP119523 | ||
Organism | Pasteurella multocida strain LXSS001 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | A0A849CFF7 |
Locus tag | P0Y37_RS04570 | Protein ID | WP_014667974.1 |
Coordinates | 944002..944286 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A849CG04 |
Locus tag | P0Y37_RS04565 | Protein ID | WP_014391174.1 |
Coordinates | 943712..944005 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0Y37_RS04545 | 938873..939964 | - | 1092 | WP_005756839.1 | L-ascorbate 6-phosphate lactonase | - |
P0Y37_RS04550 | 940317..942107 | + | 1791 | WP_014667976.1 | PTS ascorbate-specific subunit IIBC | - |
P0Y37_RS04555 | 942152..942619 | + | 468 | WP_014391172.1 | PTS sugar transporter subunit IIA | - |
P0Y37_RS04560 | 942637..943314 | + | 678 | WP_014667975.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
P0Y37_RS04565 | 943712..944005 | - | 294 | WP_014391174.1 | putative addiction module antidote protein | Antitoxin |
P0Y37_RS04570 | 944002..944286 | - | 285 | WP_014667974.1 | addiction module protein | Toxin |
P0Y37_RS04580 | 945580..945841 | - | 262 | Protein_874 | hypothetical protein | - |
P0Y37_RS04585 | 946153..946338 | - | 186 | WP_016534551.1 | hypothetical protein | - |
P0Y37_RS04590 | 946638..948824 | - | 2187 | WP_014667973.1 | S8 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 945580..945741 | 161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10702.41 Da Isoelectric Point: 10.2849
>T274140 WP_014667974.1 NZ_CP119523:c944286-944002 [Pasteurella multocida]
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
VGRLREVKNLSAKAAVLARINRVMNGNLGDHKSIGNGLYEMRIIKGSGYRVYYGQYREVTYLLICGGDKSTQKSDIVKAR
ELWKEIKQQEEVKV
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CFF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A849CG04 |