Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 2133948..2134492 Replicon chromosome
Accession NZ_CP119521
Organism Vibrio furnissii strain C1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P2C01_RS09810 Protein ID WP_172559614.1
Coordinates 2133948..2134247 (-) Length 100 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A0Q2N1Z8
Locus tag P2C01_RS09815 Protein ID WP_055466056.1
Coordinates 2134235..2134492 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2C01_RS09780 2129575..2130567 + 993 WP_004725095.1 flagellar motor protein MotB -
P2C01_RS09785 2130642..2130929 + 288 WP_014204723.1 hypothetical protein -
P2C01_RS09790 2131066..2131596 + 531 WP_055466057.1 copper resistance protein NlpE -
P2C01_RS09795 2131674..2132507 - 834 WP_275722533.1 SDR family oxidoreductase -
P2C01_RS09800 2132676..2133050 + 375 WP_199251200.1 helix-turn-helix domain-containing protein -
P2C01_RS09805 2133246..2133521 + 276 WP_004725092.1 hypothetical protein -
P2C01_RS09810 2133948..2134247 - 300 WP_172559614.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P2C01_RS09815 2134235..2134492 - 258 WP_055466056.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P2C01_RS09820 2134640..2135116 - 477 WP_055466055.1 hypothetical protein -
P2C01_RS09825 2135183..2135314 - 132 WP_275722538.1 DUF3265 domain-containing protein -
P2C01_RS09830 2135298..2135630 - 333 WP_275722540.1 hypothetical protein -
P2C01_RS09835 2135692..2135814 - 123 WP_275724417.1 DUF3265 domain-containing protein -
P2C01_RS09840 2135811..2136218 - 408 WP_275722542.1 SH3 domain-containing protein -
P2C01_RS09845 2136942..2137706 - 765 WP_275722543.1 IclR family transcriptional regulator -
P2C01_RS09850 2137821..2139128 - 1308 WP_024373226.1 TRAP transporter large permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11475.40 Da        Isoelectric Point: 4.8604

>T274139 WP_172559614.1 NZ_CP119521:c2134247-2133948 [Vibrio furnissii]
MAEIIWTEPALSDLNDIAEYIALENVAAAKQLVQTIFAKVERLENFPESGRIPPELAHLSYRELVVNPCRIFYKFDGDKV
FILFVMRSERDLRKFLLGM

Download         Length: 300 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9659.20 Da        Isoelectric Point: 8.5255

>AT274139 WP_055466056.1 NZ_CP119521:c2134492-2134235 [Vibrio furnissii]
MKVELVTSLKRQATKILADLRSTKEPVLITEHGKPSAYLVDVEDYEFMQNRLAILEGIARGERAFADGKVVSHEEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0Q2N1Z8

References