Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/-
Location 4167961..4168544 Replicon chromosome
Accession NZ_CP119520
Organism Telluria mixta strain ACM 1762

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag P0M04_RS18575 Protein ID WP_259447612.1
Coordinates 4168161..4168544 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag P0M04_RS18570 Protein ID WP_259447613.1
Coordinates 4167961..4168164 (+) Length 68 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0M04_RS18545 (P0M04_18555) 4165140..4165481 - 342 WP_259447618.1 DUF4124 domain-containing protein -
P0M04_RS18550 (P0M04_18560) 4165544..4166497 - 954 WP_259447617.1 DMT family transporter -
P0M04_RS18555 (P0M04_18565) 4166587..4166712 - 126 WP_259447616.1 hypothetical protein -
P0M04_RS18560 (P0M04_18570) 4166974..4167168 + 195 WP_259447615.1 hypothetical protein -
P0M04_RS18565 (P0M04_18575) 4167179..4167469 + 291 WP_259447614.1 hypothetical protein -
P0M04_RS18570 (P0M04_18580) 4167961..4168164 + 204 WP_259447613.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P0M04_RS18575 (P0M04_18585) 4168161..4168544 + 384 WP_259447612.1 VapC toxin family PIN domain ribonuclease Toxin
P0M04_RS18580 (P0M04_18590) 4168578..4169030 - 453 WP_259447611.1 hypothetical protein -
P0M04_RS18585 (P0M04_18595) 4169023..4169751 - 729 WP_259447610.1 AraC family transcriptional regulator -
P0M04_RS18590 (P0M04_18600) 4169997..4170356 - 360 WP_259447609.1 YXWGXW repeat-containing protein -
P0M04_RS18595 (P0M04_18605) 4170464..4171810 - 1347 WP_259447608.1 ATP-binding protein -
P0M04_RS18600 (P0M04_18610) 4171840..4172604 - 765 WP_259447607.1 two-component system response regulator OmpR -
P0M04_RS18605 (P0M04_18615) 4172824..4173201 + 378 WP_259447606.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13866.07 Da        Isoelectric Point: 6.4537

>T274138 WP_259447612.1 NZ_CP119520:4168161-4168544 [Telluria mixta]
MNDVLVDTSVWVDHIRNRNEDLVSLLTLDRVLSHPLIVTELACGTPPTPRSRALADIATLPQARQAALEEVRGFIEREQL
YGLGCGVVGLALLASTLLTPGARLWSLDRRLAQLAQRFGAAFLPALQ

Download         Length: 384 bp

Antitoxin


Download         Length: 68 a.a.        Molecular weight: 7382.38 Da        Isoelectric Point: 4.5258

>AT274138 WP_259447613.1 NZ_CP119520:4167961-4168164 [Telluria mixta]
MRTTVTIDDALYEKALEMADPDMDKADLFREAIKTFVRVQAARRLASLGGTAPDMADIPRRSGGPEE

Download         Length: 204 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References