Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 941588..942394 | Replicon | plasmid pDA100 |
Accession | NZ_CP119424 | ||
Organism | Photobacterium sp. DA100 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A0C5WLA1 |
Locus tag | PTW35_RS22010 | Protein ID | WP_044621084.1 |
Coordinates | 941858..942394 (+) | Length | 179 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PTW35_RS22005 | Protein ID | WP_044621903.1 |
Coordinates | 941588..941857 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PTW35_RS21985 (PTW35_21985) | 937140..937913 | + | 774 | WP_281028990.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
PTW35_RS21990 (PTW35_21990) | 937913..938842 | + | 930 | WP_281028991.1 | FAD-binding protein | - |
PTW35_RS21995 (PTW35_21995) | 938870..939832 | - | 963 | WP_281028992.1 | LysR family transcriptional regulator | - |
PTW35_RS22000 (PTW35_22000) | 940089..941465 | + | 1377 | WP_044621085.1 | MATE family efflux transporter | - |
PTW35_RS22005 (PTW35_22005) | 941588..941857 | + | 270 | WP_044621903.1 | DUF1778 domain-containing protein | Antitoxin |
PTW35_RS22010 (PTW35_22010) | 941858..942394 | + | 537 | WP_044621084.1 | GNAT family N-acetyltransferase | Toxin |
PTW35_RS22015 (PTW35_22015) | 942439..942849 | - | 411 | WP_044621083.1 | SPOR domain-containing protein | - |
PTW35_RS22020 (PTW35_22020) | 943183..943566 | + | 384 | WP_044621082.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
PTW35_RS22025 (PTW35_22025) | 943570..944871 | + | 1302 | WP_281028993.1 | Y-family DNA polymerase | - |
PTW35_RS22030 (PTW35_22030) | 944981..945232 | + | 252 | WP_281028994.1 | hypothetical protein | - |
PTW35_RS22035 (PTW35_22035) | 945308..946258 | - | 951 | WP_281028995.1 | putative sulfate exporter family transporter | - |
PTW35_RS22040 (PTW35_22040) | 946411..946734 | - | 324 | WP_281028996.1 | YdbL family protein | - |
PTW35_RS22045 (PTW35_22045) | 946753..946968 | - | 216 | WP_044621077.1 | YnbE family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | qnrS5 | - | 1..2139191 | 2139191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 179 a.a. Molecular weight: 20094.55 Da Isoelectric Point: 9.1446
>T274137 WP_044621084.1 NZ_CP119424:941858-942394 [Photobacterium sp. DA100]
VSWAKEFIELDKKLHDRASFDCGEPELNTFIQTQAAKHMQAGISRTMVLPALLPLPNQKRPICAFYSIAPSSICRDTLPA
AMAKKLPKYPIPVFLLAQLAVHHEYHGNGLGKVSLVKALRYLWQVNAHMRAYAIVVDCLSSEAESFYTKYGFEVLCEHNG
RVRMFIPMKTVGQLFEGR
VSWAKEFIELDKKLHDRASFDCGEPELNTFIQTQAAKHMQAGISRTMVLPALLPLPNQKRPICAFYSIAPSSICRDTLPA
AMAKKLPKYPIPVFLLAQLAVHHEYHGNGLGKVSLVKALRYLWQVNAHMRAYAIVVDCLSSEAESFYTKYGFEVLCEHNG
RVRMFIPMKTVGQLFEGR
Download Length: 537 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|