Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-RelB |
Location | 608732..609339 | Replicon | chromosome |
Accession | NZ_CP119416 | ||
Organism | Agrobacterium fabrum strain A8196 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q7D0B7 |
Locus tag | P0M24_RS03080 | Protein ID | WP_010971265.1 |
Coordinates | 608732..609067 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | A9CJP8 |
Locus tag | P0M24_RS03085 | Protein ID | WP_010971266.1 |
Coordinates | 609064..609339 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0M24_RS03065 (P0M24_03065) | 604837..607032 | - | 2196 | WP_035256415.1 | transglycosylase domain-containing protein | - |
P0M24_RS03070 (P0M24_03070) | 607289..607768 | + | 480 | WP_010971263.1 | YcgN family cysteine cluster protein | - |
P0M24_RS03075 (P0M24_03075) | 607880..608704 | + | 825 | WP_010971264.1 | class D beta-lactamase | - |
P0M24_RS03080 (P0M24_03080) | 608732..609067 | - | 336 | WP_010971265.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
P0M24_RS03085 (P0M24_03085) | 609064..609339 | - | 276 | WP_010971266.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P0M24_RS03090 (P0M24_03090) | 609447..610055 | + | 609 | WP_010971267.1 | class I SAM-dependent methyltransferase | - |
P0M24_RS03095 (P0M24_03095) | 610231..612816 | + | 2586 | WP_035256421.1 | heavy metal translocating P-type ATPase | - |
P0M24_RS03100 (P0M24_03100) | 612813..613235 | + | 423 | WP_006311241.1 | Cu(I)-responsive transcriptional regulator | - |
P0M24_RS03105 (P0M24_03105) | 613288..613488 | + | 201 | WP_006311242.1 | heavy-metal-associated domain-containing protein | - |
P0M24_RS03110 (P0M24_03110) | 613558..613824 | + | 267 | WP_010971270.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
P0M24_RS03115 (P0M24_03115) | 613824..614183 | + | 360 | WP_006311244.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12991.86 Da Isoelectric Point: 10.0059
>T274134 WP_010971265.1 NZ_CP119416:c609067-608732 [Agrobacterium fabrum]
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
VTNKKDHGKDAALKRATLPRRSDFTKQFIKDWQRLNNSGRYDMVRLKEIMLLLIANGAPLPTQFRDHELTGDWRDHRECH
VGGDFLLIYTVDEKQNLLIFTRAGTHAELFR
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|