Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 354849..355329 Replicon chromosome
Accession NZ_CP119416
Organism Agrobacterium fabrum strain A8196

Toxin (Protein)


Gene name pasB Uniprot ID A9CK22
Locus tag P0M24_RS01785 Protein ID WP_010971059.1
Coordinates 354849..355118 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A9CK21
Locus tag P0M24_RS01790 Protein ID WP_010971060.1
Coordinates 355102..355329 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0M24_RS01755 (P0M24_01755) 349900..350676 - 777 WP_010971054.1 L,D-transpeptidase -
P0M24_RS01760 (P0M24_01760) 350915..351544 + 630 WP_010971055.1 DNA-3-methyladenine glycosylase I -
P0M24_RS01765 (P0M24_01765) 351541..351984 + 444 WP_010972617.1 hypothetical protein -
P0M24_RS01770 (P0M24_01770) 352010..353053 - 1044 WP_035256280.1 YeiH family protein -
P0M24_RS01775 (P0M24_01775) 353135..354052 + 918 WP_010971057.1 LysR family transcriptional regulator -
P0M24_RS01780 (P0M24_01780) 354078..354842 - 765 WP_010971058.1 hypothetical protein -
P0M24_RS01785 (P0M24_01785) 354849..355118 - 270 WP_010971059.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P0M24_RS01790 (P0M24_01790) 355102..355329 - 228 WP_010971060.1 DUF6290 family protein Antitoxin
P0M24_RS01795 (P0M24_01795) 355486..357009 + 1524 WP_010971061.1 histidine--tRNA ligase -
P0M24_RS01800 (P0M24_01800) 357014..357382 + 369 WP_010971062.1 VOC family protein -
P0M24_RS01805 (P0M24_01805) 357399..358526 + 1128 WP_010971063.1 ATP phosphoribosyltransferase regulatory subunit -
P0M24_RS01810 (P0M24_01810) 358523..359215 + 693 WP_010971064.1 ATP phosphoribosyltransferase -
P0M24_RS01815 (P0M24_01815) 359280..359726 - 447 WP_006313161.1 DoxX family protein -
P0M24_RS01820 (P0M24_01820) 359882..360301 - 420 WP_230060738.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Protein of unknown function DUF6290

(6-73)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10746.46 Da        Isoelectric Point: 9.9414

>T274133 WP_010971059.1 NZ_CP119416:c355118-354849 [Agrobacterium fabrum]
VIWTIEYHTLVQKEMRKINPEVRRRIRSFLHERLAALDDPRQIGATLQGSELGNFWRYRVGDYRIICDIQDQKLVVLVVE
IGHRREIYR

Download         Length: 270 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8937.97 Da        Isoelectric Point: 4.7254

>AT274133 WP_010971060.1 NZ_CP119416:c355329-355102 [Agrobacterium fabrum]
MSKQTAIRLPDETYERLKALSERTGRTSAYYIREAIEKHIEDMEDLYLAEEATRRIQRGESKIISAEEFWRDLDN

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A9CK22

Antitoxin

Source ID Structure
AlphaFold DB A9CK21

References