Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1711407..1712083 | Replicon | chromosome |
Accession | NZ_CP119409 | ||
Organism | Rhizobium gei strain ZFJT.2T |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PY308_RS08290 | Protein ID | WP_275790055.1 |
Coordinates | 1711730..1712083 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PY308_RS08285 | Protein ID | WP_275790053.1 |
Coordinates | 1711407..1711661 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY308_RS08255 | 1707140..1707409 | - | 270 | WP_275790035.1 | hypothetical protein | - |
PY308_RS08260 | 1707537..1707959 | - | 423 | WP_275790037.1 | TIGR02301 family protein | - |
PY308_RS08265 | 1707956..1708435 | - | 480 | WP_275790040.1 | NUDIX hydrolase | - |
PY308_RS08270 | 1708495..1709268 | + | 774 | WP_275790043.1 | SOS response-associated peptidase | - |
PY308_RS08275 | 1709275..1709445 | - | 171 | WP_275790046.1 | hypothetical protein | - |
PY308_RS08280 | 1709848..1711350 | + | 1503 | WP_275790049.1 | cysteine--tRNA ligase | - |
PY308_RS08285 | 1711407..1711661 | + | 255 | WP_275790053.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
PY308_RS08290 | 1711730..1712083 | + | 354 | WP_275790055.1 | PIN domain-containing protein | Toxin |
PY308_RS08295 | 1712080..1712562 | + | 483 | WP_275790058.1 | GFA family protein | - |
PY308_RS08300 | 1712559..1713047 | + | 489 | WP_275790060.1 | GFA family protein | - |
PY308_RS08305 | 1713044..1713514 | + | 471 | WP_275790061.1 | GFA family protein | - |
PY308_RS08310 | 1713556..1714515 | + | 960 | WP_275790064.1 | prolyl aminopeptidase | - |
PY308_RS08315 | 1714739..1716352 | + | 1614 | WP_275790067.1 | citramalate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 12807.58 Da Isoelectric Point: 4.5610
>T274129 WP_275790055.1 NZ_CP119409:1711730-1712083 [Rhizobium gei]
VRRVETVGSDKLCISALVASELRYGAVKKQSERLASLIENILERLDIVAYETAATVHYADIRDQLTGSGNLIGPMDLLIA
AHARALDLTLVTDNTAEFSRVDGLKLENWIADQETVP
VRRVETVGSDKLCISALVASELRYGAVKKQSERLASLIENILERLDIVAYETAATVHYADIRDQLTGSGNLIGPMDLLIA
AHARALDLTLVTDNTAEFSRVDGLKLENWIADQETVP
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|