Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1656310..1656869 | Replicon | chromosome |
Accession | NZ_CP119409 | ||
Organism | Rhizobium gei strain ZFJT.2T |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PY308_RS07960 | Protein ID | WP_275789907.1 |
Coordinates | 1656310..1656675 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PY308_RS07965 | Protein ID | WP_275789911.1 |
Coordinates | 1656675..1656869 (-) | Length | 65 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY308_RS07940 | 1652013..1652231 | + | 219 | WP_275789897.1 | hypothetical protein | - |
PY308_RS07945 | 1652482..1653126 | + | 645 | WP_275789899.1 | hypothetical protein | - |
PY308_RS07950 | 1653129..1654211 | + | 1083 | WP_275789901.1 | ImmA/IrrE family metallo-endopeptidase | - |
PY308_RS07955 | 1654639..1656303 | + | 1665 | WP_275789904.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
PY308_RS07960 | 1656310..1656675 | - | 366 | WP_275789907.1 | VapC toxin family PIN domain ribonuclease | Toxin |
PY308_RS07965 | 1656675..1656869 | - | 195 | WP_275789911.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PY308_RS07970 | 1657033..1657650 | + | 618 | WP_275789914.1 | L,D-transpeptidase | - |
PY308_RS07975 | 1657657..1658226 | - | 570 | WP_275789915.1 | histidine phosphatase family protein | - |
PY308_RS07980 | 1658423..1658860 | - | 438 | WP_275789918.1 | DoxX family protein | - |
PY308_RS07985 | 1659170..1660066 | + | 897 | WP_275789921.1 | diacylglycerol kinase family lipid kinase | - |
PY308_RS07990 | 1660083..1661102 | - | 1020 | WP_275789924.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13585.76 Da Isoelectric Point: 6.4797
>T274128 WP_275789907.1 NZ_CP119409:c1656675-1656310 [Rhizobium gei]
MILVDASVWIDHLRAPVEELQALLESSSVLMHPFVIGEIGLGSIPRYDFTMRGLSKFPLATKARDDDVLYLVREHRLYGR
GVGYIDVHLLASTLLTPEACLWTRDKRLAEIAASFGVGYNR
MILVDASVWIDHLRAPVEELQALLESSSVLMHPFVIGEIGLGSIPRYDFTMRGLSKFPLATKARDDDVLYLVREHRLYGR
GVGYIDVHLLASTLLTPEACLWTRDKRLAEIAASFGVGYNR
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|