Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 1424507..1425138 | Replicon | chromosome |
| Accession | NZ_CP119409 | ||
| Organism | Rhizobium gei strain ZFJT.2T | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PY308_RS06675 | Protein ID | WP_275789440.1 |
| Coordinates | 1424734..1425138 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PY308_RS06670 | Protein ID | WP_275791042.1 |
| Coordinates | 1424507..1424737 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PY308_RS06660 | 1419807..1420700 | + | 894 | WP_275789437.1 | DsbA family protein | - |
| PY308_RS06665 | 1420977..1424441 | + | 3465 | WP_275789438.1 | chromosome segregation SMC family protein | - |
| PY308_RS06670 | 1424507..1424737 | + | 231 | WP_275791042.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PY308_RS06675 | 1424734..1425138 | + | 405 | WP_275789440.1 | PIN domain-containing protein | Toxin |
| PY308_RS06680 | 1425298..1427964 | + | 2667 | WP_275789443.1 | pyruvate, phosphate dikinase | - |
| PY308_RS06685 | 1428077..1428499 | + | 423 | WP_275789445.1 | YciI family protein | - |
| PY308_RS06690 | 1428553..1429815 | + | 1263 | WP_275789447.1 | RNA polymerase sigma factor | - |
| PY308_RS06695 | 1429824..1430078 | - | 255 | WP_275789449.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14786.00 Da Isoelectric Point: 6.4821
>T274127 WP_275789440.1 NZ_CP119409:1424734-1425138 [Rhizobium gei]
MRAFFDTNILVYAFSTDPKREQANATIAEGGVISAQVLNELTHVFRRKQKKEWPAIEAALKLMTSRLAEIVPLTAELHAA
ALPIARDHGLTIYDALIVAAAMEAGCDTLFSEDMQHGRTFDRLTIRNPFLGTSA
MRAFFDTNILVYAFSTDPKREQANATIAEGGVISAQVLNELTHVFRRKQKKEWPAIEAALKLMTSRLAEIVPLTAELHAA
ALPIARDHGLTIYDALIVAAAMEAGCDTLFSEDMQHGRTFDRLTIRNPFLGTSA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|