Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-ChpS |
Location | 826644..827233 | Replicon | chromosome |
Accession | NZ_CP119409 | ||
Organism | Rhizobium gei strain ZFJT.2T |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | PY308_RS03875 | Protein ID | WP_275788361.1 |
Coordinates | 826644..826973 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | PY308_RS03880 | Protein ID | WP_275788365.1 |
Coordinates | 826973..827233 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY308_RS03855 | 822298..822723 | + | 426 | WP_275788352.1 | DUF4174 domain-containing protein | - |
PY308_RS03860 | 822776..824989 | - | 2214 | WP_275788355.1 | 3-hydroxyacyl-CoA dehydrogenase NAD-binding domain-containing protein | - |
PY308_RS03865 | 825011..825388 | - | 378 | WP_275788356.1 | cupin domain-containing protein | - |
PY308_RS03870 | 825393..826601 | - | 1209 | WP_275788358.1 | acetyl-CoA C-acetyltransferase | - |
PY308_RS03875 | 826644..826973 | - | 330 | WP_275788361.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PY308_RS03880 | 826973..827233 | - | 261 | WP_275788365.1 | antitoxin | Antitoxin |
PY308_RS03885 | 827294..829090 | - | 1797 | WP_275788368.1 | acyl-CoA dehydrogenase C-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11942.75 Da Isoelectric Point: 10.4532
>T274126 WP_275788361.1 NZ_CP119409:c826973-826644 [Rhizobium gei]
MERGDIWFADLEPTRGHEQAKSRYCLIVSQGNFNRLGLQFIAPITIGGNFARAKGFSVSLSGAGTRTSGVILCHQVRAID
VKARGGRFIEKAPPFITAEVLARISTFFE
MERGDIWFADLEPTRGHEQAKSRYCLIVSQGNFNRLGLQFIAPITIGGNFARAKGFSVSLSGAGTRTSGVILCHQVRAID
VKARGGRFIEKAPPFITAEVLARISTFFE
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|