Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 8838..9469 | Replicon | chromosome |
Accession | NZ_CP119409 | ||
Organism | Rhizobium gei strain ZFJT.2T |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PY308_RS00055 | Protein ID | WP_275786631.1 |
Coordinates | 8838..9224 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PY308_RS00060 | Protein ID | WP_275786633.1 |
Coordinates | 9221..9469 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY308_RS00030 | 4385..4729 | - | 345 | WP_275786617.1 | transcriptional regulator | - |
PY308_RS00035 | 4838..5458 | - | 621 | WP_275786620.1 | response regulator FixJ | - |
PY308_RS00040 | 5445..6926 | - | 1482 | WP_275786623.1 | PAS domain S-box protein | - |
PY308_RS00045 | 7134..7580 | - | 447 | WP_275786625.1 | pseudoazurin | - |
PY308_RS00050 | 7777..8835 | - | 1059 | WP_275786628.1 | site-specific integrase | - |
PY308_RS00055 | 8838..9224 | - | 387 | WP_275786631.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PY308_RS00060 | 9221..9469 | - | 249 | WP_275786633.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PY308_RS00065 | 9732..11501 | - | 1770 | WP_275786636.1 | calcium-binding protein | - |
PY308_RS00070 | 11660..11989 | - | 330 | WP_275786637.1 | hypothetical protein | - |
PY308_RS00075 | 12149..13048 | + | 900 | WP_275786639.1 | LysR family transcriptional regulator | - |
PY308_RS00080 | 13343..13825 | + | 483 | WP_275786642.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13956.80 Da Isoelectric Point: 4.9152
>T274125 WP_275786631.1 NZ_CP119409:c9224-8838 [Rhizobium gei]
MIVDTSALVAILYREAEAASFVERIHEAETARISVANYVELSMVVESQLGSNGMRQAEAFFRRAGIIIEPVTVEHGELAR
QAFLDFGKGRHKASLNFGDCFAYALAKASGEPLLFKGNDFSQTDVQAA
MIVDTSALVAILYREAEAASFVERIHEAETARISVANYVELSMVVESQLGSNGMRQAEAFFRRAGIIIEPVTVEHGELAR
QAFLDFGKGRHKASLNFGDCFAYALAKASGEPLLFKGNDFSQTDVQAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|