Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4604298..4605108 | Replicon | chromosome |
Accession | NZ_CP119408 | ||
Organism | Klebsiella pneumoniae strain NW202109 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | P0M34_RS22605 | Protein ID | WP_048299784.1 |
Coordinates | 4604298..4604831 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | P0M34_RS22610 | Protein ID | WP_002887278.1 |
Coordinates | 4604842..4605108 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0M34_RS22600 (4603129) | 4603129..4604250 | + | 1122 | WP_004214138.1 | cupin domain-containing protein | - |
P0M34_RS22605 (4604298) | 4604298..4604831 | - | 534 | WP_048299784.1 | type II toxin-antitoxin system toxin KacT | Toxin |
P0M34_RS22610 (4604842) | 4604842..4605108 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
P0M34_RS22615 (4605211) | 4605211..4606644 | - | 1434 | WP_040210879.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
P0M34_RS22620 (4606634) | 4606634..4607317 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
P0M34_RS22625 (4607489) | 4607489..4608874 | + | 1386 | WP_040089708.1 | efflux transporter outer membrane subunit | - |
P0M34_RS22630 (4608892) | 4608892..4609236 | + | 345 | WP_023287080.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19826.65 Da Isoelectric Point: 5.2614
>T274122 WP_048299784.1 NZ_CP119408:c4604831-4604298 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGYDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|