Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3988402..3989021 Replicon chromosome
Accession NZ_CP119408
Organism Klebsiella pneumoniae strain NW202109

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P0M34_RS19665 Protein ID WP_002892050.1
Coordinates 3988803..3989021 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P0M34_RS19660 Protein ID WP_002892066.1
Coordinates 3988402..3988776 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0M34_RS19650 (3983554) 3983554..3984747 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P0M34_RS19655 (3984770) 3984770..3987916 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P0M34_RS19660 (3988402) 3988402..3988776 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P0M34_RS19665 (3988803) 3988803..3989021 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P0M34_RS19670 (3989180) 3989180..3989746 + 567 WP_002892030.1 maltose O-acetyltransferase -
P0M34_RS19675 (3989718) 3989718..3989858 - 141 WP_004147370.1 hypothetical protein -
P0M34_RS19680 (3989879) 3989879..3990349 + 471 WP_002892026.1 YlaC family protein -
P0M34_RS19685 (3990324) 3990324..3991775 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P0M34_RS19690 (3991876) 3991876..3992574 + 699 WP_002892021.1 GNAT family protein -
P0M34_RS19695 (3992571) 3992571..3992711 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P0M34_RS19700 (3992711) 3992711..3992974 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T274121 WP_002892050.1 NZ_CP119408:3988803-3989021 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT274121 WP_002892066.1 NZ_CP119408:3988402-3988776 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References