Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3988402..3989021 | Replicon | chromosome |
| Accession | NZ_CP119408 | ||
| Organism | Klebsiella pneumoniae strain NW202109 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | P0M34_RS19665 | Protein ID | WP_002892050.1 |
| Coordinates | 3988803..3989021 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | P0M34_RS19660 | Protein ID | WP_002892066.1 |
| Coordinates | 3988402..3988776 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0M34_RS19650 (3983554) | 3983554..3984747 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P0M34_RS19655 (3984770) | 3984770..3987916 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| P0M34_RS19660 (3988402) | 3988402..3988776 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| P0M34_RS19665 (3988803) | 3988803..3989021 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| P0M34_RS19670 (3989180) | 3989180..3989746 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| P0M34_RS19675 (3989718) | 3989718..3989858 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| P0M34_RS19680 (3989879) | 3989879..3990349 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| P0M34_RS19685 (3990324) | 3990324..3991775 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| P0M34_RS19690 (3991876) | 3991876..3992574 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| P0M34_RS19695 (3992571) | 3992571..3992711 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| P0M34_RS19700 (3992711) | 3992711..3992974 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T274121 WP_002892050.1 NZ_CP119408:3988803-3989021 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT274121 WP_002892066.1 NZ_CP119408:3988402-3988776 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |