Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 6200..6801 | Replicon | plasmid pMRE162 UK |
| Accession | NZ_CP119405 | ||
| Organism | Escherichia coli strain MRE162 substr. UK | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9ZW91 |
| Locus tag | PX811_RS22860 | Protein ID | WP_001216033.1 |
| Coordinates | 6421..6801 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PX811_RS22855 | Protein ID | WP_001190712.1 |
| Coordinates | 6200..6421 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX811_RS22825 (PX811_004564) | 1817..1989 | + | 173 | Protein_1 | hypothetical protein | - |
| PX811_RS22830 (PX811_004565) | 2323..3204 | + | 882 | WP_032194718.1 | hypothetical protein | - |
| PX811_RS22835 (PX811_004566) | 3201..3563 | + | 363 | WP_001261543.1 | hypothetical protein | - |
| PX811_RS22840 (PX811_004567) | 4622..4978 | - | 357 | WP_001062545.1 | hypothetical protein | - |
| PX811_RS22845 (PX811_004568) | 4979..5377 | - | 399 | WP_001648136.1 | hypothetical protein | - |
| PX811_RS22850 (PX811_004569) | 5738..6127 | + | 390 | WP_000506724.1 | S24 family peptidase | - |
| PX811_RS22855 (PX811_004570) | 6200..6421 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PX811_RS22860 (PX811_004571) | 6421..6801 | + | 381 | WP_001216033.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PX811_RS22865 (PX811_004572) | 6806..6985 | + | 180 | WP_001354541.1 | hypothetical protein | - |
| PX811_RS22870 (PX811_004573) | 7013..8059 | + | 1047 | WP_275772816.1 | DUF968 domain-containing protein | - |
| PX811_RS22875 | 8226..8672 | + | 447 | WP_244566449.1 | ORF6N domain-containing protein | - |
| PX811_RS22880 | 8769..9293 | + | 525 | WP_244565655.1 | phage antirepressor KilAC domain-containing protein | - |
| PX811_RS22885 (PX811_004575) | 9326..10177 | - | 852 | WP_000611652.1 | phage repressor protein C1 | - |
| PX811_RS22890 (PX811_004576) | 10288..10497 | - | 210 | WP_032195054.1 | hypothetical protein | - |
| PX811_RS22895 (PX811_004577) | 11102..11323 | + | 222 | WP_042630942.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..76855 | 76855 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13571.31 Da Isoelectric Point: 5.6343
>T274112 WP_001216033.1 NZ_CP119405:6421-6801 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9ZW91 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |