Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4013646..4014444 Replicon chromosome
Accession NZ_CP119404
Organism Escherichia coli strain MRE162 substr. UK

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1X1M0U2
Locus tag PX811_RS19585 Protein ID WP_000854919.1
Coordinates 4013646..4014023 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2G4AEZ5
Locus tag PX811_RS19590 Protein ID WP_001285608.1
Coordinates 4014070..4014444 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX811_RS19550 (4008859) 4008859..4009965 + 1107 WP_001353974.1 N-acetylneuraminate epimerase -
PX811_RS19555 (4010030) 4010030..4011010 + 981 WP_001295601.1 sialate O-acetylesterase -
PX811_RS19560 (4011018) 4011018..4011668 - 651 WP_001037966.1 HNH endonuclease -
PX811_RS19565 (4011805) 4011805..4011948 + 144 Protein_3823 HNH endonuclease -
PX811_RS19570 (4012716) 4012716..4012859 - 144 Protein_3824 hypothetical protein -
PX811_RS19575 (4012944) 4012944..4013141 - 198 WP_001327226.1 DUF957 domain-containing protein -
PX811_RS19580 (4013161) 4013161..4013649 - 489 WP_000777664.1 DUF5983 family protein -
PX811_RS19585 (4013646) 4013646..4014023 - 378 WP_000854919.1 TA system toxin CbtA family protein Toxin
PX811_RS19590 (4014070) 4014070..4014444 - 375 WP_001285608.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PX811_RS19595 (4014524) 4014524..4014745 - 222 WP_000692350.1 DUF987 domain-containing protein -
PX811_RS19600 (4014832) 4014832..4015308 - 477 WP_001560293.1 RadC family protein -
PX811_RS19605 (4015323) 4015323..4015802 - 480 WP_000706978.1 antirestriction protein -
PX811_RS19610 (4016068) 4016068..4016886 - 819 WP_001175165.1 DUF932 domain-containing protein -
PX811_RS19615 (4016976) 4016976..4017209 - 234 WP_001278293.1 DUF905 family protein -
PX811_RS19620 (4017215) 4017215..4017892 - 678 WP_001097302.1 hypothetical protein -
PX811_RS19625 (4018040) 4018040..4018720 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimE / fimB 4004994..4034545 29551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14037.97 Da        Isoelectric Point: 7.9086

>T274110 WP_000854919.1 NZ_CP119404:c4014023-4013646 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13610.37 Da        Isoelectric Point: 5.5051

>AT274110 WP_001285608.1 NZ_CP119404:c4014444-4014070 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1X1M0U2

Antitoxin

Source ID Structure
AlphaFold DB A0A2G4AEZ5

References