Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2417009..2417647 | Replicon | chromosome |
| Accession | NZ_CP119404 | ||
| Organism | Escherichia coli strain MRE162 substr. UK | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PX811_RS11750 | Protein ID | WP_000813794.1 |
| Coordinates | 2417471..2417647 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PX811_RS11745 | Protein ID | WP_077875187.1 |
| Coordinates | 2417009..2417425 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX811_RS11725 (2412161) | 2412161..2413102 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
| PX811_RS11730 (2413103) | 2413103..2414116 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
| PX811_RS11735 (2414134) | 2414134..2415279 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| PX811_RS11740 (2415524) | 2415524..2416930 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
| PX811_RS11745 (2417009) | 2417009..2417425 | - | 417 | WP_077875187.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PX811_RS11750 (2417471) | 2417471..2417647 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PX811_RS11755 (2417869) | 2417869..2418099 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| PX811_RS11760 (2418191) | 2418191..2420152 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PX811_RS11765 (2420225) | 2420225..2420761 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
| PX811_RS11770 (2420853) | 2420853..2422028 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2422360..2423334 | 974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T274105 WP_000813794.1 NZ_CP119404:c2417647-2417471 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15260.66 Da Isoelectric Point: 4.7386
>AT274105 WP_077875187.1 NZ_CP119404:c2417425-2417009 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKI
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKI
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|