Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 8140..8741 Replicon plasmid pMRE162 FRA
Accession NZ_CP119403
Organism Escherichia coli strain MRE162 substr. FRA

Toxin (Protein)


Gene name doc Uniprot ID U9ZW91
Locus tag PX810_RS22845 Protein ID WP_001216033.1
Coordinates 8140..8520 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PX810_RS22850 Protein ID WP_001190712.1
Coordinates 8520..8741 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX810_RS22810 (PX810_004561) 3618..3839 - 222 WP_042630942.1 hypothetical protein -
PX810_RS22815 (PX810_004562) 4444..4653 + 210 WP_032195054.1 hypothetical protein -
PX810_RS22820 (PX810_004563) 4764..5615 + 852 WP_000611652.1 phage repressor protein C1 -
PX810_RS22825 5648..6172 - 525 WP_244565655.1 phage antirepressor KilAC domain-containing protein -
PX810_RS22830 6269..6793 - 525 WP_244565656.1 ORF6N domain-containing protein -
PX810_RS22835 (PX810_004565) 6882..7928 - 1047 WP_275772816.1 DUF968 domain-containing protein -
PX810_RS22840 (PX810_004566) 7956..8135 - 180 WP_001354541.1 hypothetical protein -
PX810_RS22845 (PX810_004567) 8140..8520 - 381 WP_001216033.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PX810_RS22850 (PX810_004568) 8520..8741 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PX810_RS22855 (PX810_004569) 8814..9203 - 390 WP_000506724.1 S24 family peptidase -
PX810_RS22860 (PX810_004570) 9555..9962 + 408 WP_001354543.1 hypothetical protein -
PX810_RS22865 (PX810_004571) 9963..10319 + 357 WP_001062545.1 hypothetical protein -
PX810_RS22870 (PX810_004572) 11378..11740 - 363 WP_001261543.1 hypothetical protein -
PX810_RS22875 (PX810_004573) 12331..12618 - 288 Protein_18 hypothetical protein -
PX810_RS22880 (PX810_004574) 12952..13124 - 173 Protein_19 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..76849 76849


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13571.31 Da        Isoelectric Point: 5.6343

>T274093 WP_001216033.1 NZ_CP119403:c8520-8140 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT274093 WP_001190712.1 NZ_CP119403:c8741-8520 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZW91

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References