Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4008317..4009115 | Replicon | chromosome |
| Accession | NZ_CP119402 | ||
| Organism | Escherichia coli strain MRE162 substr. FRA | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X1M0U2 |
| Locus tag | PX810_RS19550 | Protein ID | WP_000854919.1 |
| Coordinates | 4008317..4008694 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2G4AEZ5 |
| Locus tag | PX810_RS19555 | Protein ID | WP_001285608.1 |
| Coordinates | 4008741..4009115 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX810_RS19515 (4003530) | 4003530..4004636 | + | 1107 | WP_001353974.1 | N-acetylneuraminate epimerase | - |
| PX810_RS19520 (4004701) | 4004701..4005681 | + | 981 | WP_001295601.1 | sialate O-acetylesterase | - |
| PX810_RS19525 (4005689) | 4005689..4006339 | - | 651 | WP_001037966.1 | HNH endonuclease | - |
| PX810_RS19530 (4006476) | 4006476..4006619 | + | 144 | Protein_3816 | HNH endonuclease | - |
| PX810_RS19535 (4007387) | 4007387..4007530 | - | 144 | Protein_3817 | hypothetical protein | - |
| PX810_RS19540 (4007615) | 4007615..4007812 | - | 198 | WP_001327226.1 | DUF957 domain-containing protein | - |
| PX810_RS19545 (4007832) | 4007832..4008320 | - | 489 | WP_000777664.1 | DUF5983 family protein | - |
| PX810_RS19550 (4008317) | 4008317..4008694 | - | 378 | WP_000854919.1 | TA system toxin CbtA family protein | Toxin |
| PX810_RS19555 (4008741) | 4008741..4009115 | - | 375 | WP_001285608.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PX810_RS19560 (4009195) | 4009195..4009416 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| PX810_RS19565 (4009503) | 4009503..4009979 | - | 477 | WP_001560293.1 | RadC family protein | - |
| PX810_RS19570 (4009994) | 4009994..4010473 | - | 480 | WP_000706978.1 | antirestriction protein | - |
| PX810_RS19575 (4010739) | 4010739..4011557 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| PX810_RS19580 (4011647) | 4011647..4011880 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| PX810_RS19585 (4011886) | 4011886..4012563 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| PX810_RS19590 (4012711) | 4012711..4013391 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE / fimB | 3999665..4029216 | 29551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14037.97 Da Isoelectric Point: 7.9086
>T274091 WP_000854919.1 NZ_CP119402:c4008694-4008317 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
MKTLSDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13610.37 Da Isoelectric Point: 5.5051
>AT274091 WP_001285608.1 NZ_CP119402:c4009115-4008741 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPAITS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1M0U2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4AEZ5 |