Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3634061..3634859 | Replicon | chromosome |
| Accession | NZ_CP119402 | ||
| Organism | Escherichia coli strain MRE162 substr. FRA | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A166U9J9 |
| Locus tag | PX810_RS17715 | Protein ID | WP_000854695.1 |
| Coordinates | 3634061..3634438 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2U2UUE3 |
| Locus tag | PX810_RS17720 | Protein ID | WP_016243360.1 |
| Coordinates | 3634485..3634859 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PX810_RS17690 (3630018) | 3630018..3630176 | - | 159 | WP_000788777.1 | hypothetical protein | - |
| PX810_RS17695 (3631022) | 3631022..3632341 | + | 1320 | WP_000144689.1 | site-specific integrase | - |
| PX810_RS17700 (3632434) | 3632434..3633282 | - | 849 | WP_001280536.1 | DUF4942 domain-containing protein | - |
| PX810_RS17705 (3633367) | 3633367..3633564 | - | 198 | WP_000839228.1 | DUF957 domain-containing protein | - |
| PX810_RS17710 (3633576) | 3633576..3634064 | - | 489 | WP_032083213.1 | DUF5983 family protein | - |
| PX810_RS17715 (3634061) | 3634061..3634438 | - | 378 | WP_000854695.1 | TA system toxin CbtA family protein | Toxin |
| PX810_RS17720 (3634485) | 3634485..3634859 | - | 375 | WP_016243360.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PX810_RS17725 (3635022) | 3635022..3635243 | - | 222 | WP_000692307.1 | DUF987 domain-containing protein | - |
| PX810_RS17730 (3635312) | 3635312..3635788 | - | 477 | WP_001186773.1 | RadC family protein | - |
| PX810_RS17735 (3635804) | 3635804..3636283 | - | 480 | WP_000860084.1 | antirestriction protein | - |
| PX810_RS17740 (3636365) | 3636365..3636952 | - | 588 | Protein_3469 | DUF932 domain-containing protein | - |
| PX810_RS17745 (3636947) | 3636947..3638153 | - | 1207 | Protein_3470 | autotransporter domain-containing protein | - |
| PX810_RS17750 (3638447) | 3638447..3639319 | - | 873 | WP_001069719.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 3592500..3636283 | 43783 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14062.03 Da Isoelectric Point: 7.7531
>T274088 WP_000854695.1 NZ_CP119402:c3634438-3634061 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13810.66 Da Isoelectric Point: 7.0266
>AT274088 WP_016243360.1 NZ_CP119402:c3634859-3634485 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A166U9J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2U2UUE3 |