Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 6200..6801 Replicon plasmid pMRE162 NOR
Accession NZ_CP119401
Organism Escherichia coli strain MRE162 substr. NOR

Toxin (Protein)


Gene name doc Uniprot ID U9ZW91
Locus tag PX809_RS22840 Protein ID WP_001216033.1
Coordinates 6421..6801 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PX809_RS22835 Protein ID WP_001190712.1
Coordinates 6200..6421 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PX809_RS22805 (PX809_004561) 1817..1989 + 173 Protein_1 hypothetical protein -
PX809_RS22810 (PX809_004562) 2323..3204 + 882 WP_032194718.1 hypothetical protein -
PX809_RS22815 (PX809_004563) 3201..3563 + 363 WP_001261543.1 hypothetical protein -
PX809_RS22820 (PX809_004564) 4622..4978 - 357 WP_001062545.1 hypothetical protein -
PX809_RS22825 (PX809_004565) 4979..5377 - 399 WP_001648136.1 hypothetical protein -
PX809_RS22830 (PX809_004566) 5738..6127 + 390 WP_000506724.1 S24 family peptidase -
PX809_RS22835 (PX809_004567) 6200..6421 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PX809_RS22840 (PX809_004568) 6421..6801 + 381 WP_001216033.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PX809_RS22845 (PX809_004569) 6806..6985 + 180 WP_001354541.1 hypothetical protein -
PX809_RS22850 (PX809_004570) 7013..8059 + 1047 WP_275772816.1 DUF968 domain-containing protein -
PX809_RS22855 8148..8672 + 525 WP_244565656.1 ORF6N domain-containing protein -
PX809_RS22860 8769..9293 + 525 WP_244565655.1 phage antirepressor KilAC domain-containing protein -
PX809_RS22865 (PX809_004572) 9326..10177 - 852 WP_000611652.1 phage repressor protein C1 -
PX809_RS22870 (PX809_004573) 10288..10497 - 210 WP_032195054.1 hypothetical protein -
PX809_RS22875 (PX809_004574) 11102..11323 + 222 WP_042630942.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..76850 76850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13571.31 Da        Isoelectric Point: 5.6343

>T274074 WP_001216033.1 NZ_CP119401:6421-6801 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT274074 WP_001190712.1 NZ_CP119401:6200-6421 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZW91

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References