Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2416935..2417573 | Replicon | chromosome |
Accession | NZ_CP119400 | ||
Organism | Escherichia coli strain MRE162 substr. NOR |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PX809_RS11735 | Protein ID | WP_000813794.1 |
Coordinates | 2417397..2417573 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PX809_RS11730 | Protein ID | WP_077875187.1 |
Coordinates | 2416935..2417351 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX809_RS11710 (2412087) | 2412087..2413028 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
PX809_RS11715 (2413029) | 2413029..2414042 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
PX809_RS11720 (2414060) | 2414060..2415205 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
PX809_RS11725 (2415450) | 2415450..2416856 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
PX809_RS11730 (2416935) | 2416935..2417351 | - | 417 | WP_077875187.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PX809_RS11735 (2417397) | 2417397..2417573 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PX809_RS11740 (2417795) | 2417795..2418025 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PX809_RS11745 (2418117) | 2418117..2420078 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PX809_RS11750 (2420151) | 2420151..2420687 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
PX809_RS11755 (2420740) | 2420740..2421954 | + | 1215 | WP_071597387.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2422286..2423260 | 974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T274067 WP_000813794.1 NZ_CP119400:c2417573-2417397 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15260.66 Da Isoelectric Point: 4.7386
>AT274067 WP_077875187.1 NZ_CP119400:c2417351-2416935 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKI
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKI
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|