Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-yefM/Txe-RelB |
Location | 3174635..3175164 | Replicon | chromosome |
Accession | NZ_CP119393 | ||
Organism | Enterococcus casseliflavus strain ASE4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P0G38_RS14935 | Protein ID | WP_087626849.1 |
Coordinates | 3174635..3174901 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A377KQM1 |
Locus tag | P0G38_RS14940 | Protein ID | WP_010748737.1 |
Coordinates | 3174901..3175164 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0G38_RS14920 (P0G38_14920) | 3169892..3170812 | + | 921 | WP_010748740.1 | osmoprotectant ABC transporter substrate-binding protein | - |
P0G38_RS14925 (P0G38_14925) | 3170817..3171479 | + | 663 | WP_005227316.1 | ABC transporter permease | - |
P0G38_RS14930 (P0G38_14930) | 3171611..3174442 | - | 2832 | WP_275852681.1 | discoidin domain-containing protein | - |
P0G38_RS14935 (P0G38_14935) | 3174635..3174901 | - | 267 | WP_087626849.1 | Txe/YoeB family addiction module toxin | Toxin |
P0G38_RS14940 (P0G38_14940) | 3174901..3175164 | - | 264 | WP_010748737.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P0G38_RS14945 (P0G38_14945) | 3175319..3177259 | - | 1941 | WP_275852687.1 | glycoside hydrolase family 127 protein | - |
P0G38_RS14950 (P0G38_14950) | 3177309..3177941 | - | 633 | WP_275852689.1 | DUF624 domain-containing protein | - |
P0G38_RS14955 (P0G38_14955) | 3177946..3178839 | - | 894 | WP_016609627.1 | carbohydrate ABC transporter permease | - |
P0G38_RS14960 (P0G38_14960) | 3178852..3179775 | - | 924 | WP_016609626.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10612.14 Da Isoelectric Point: 10.3322
>T274052 WP_087626849.1 NZ_CP119393:c3174901-3174635 [Enterococcus casseliflavus]
MRSDTVTIKNSAKVDLRKIKQSNLKKQFEEVIQALKEDPYMPTQSFEKLRPTHEGRYSRRLSRQHRVVYKVDEKNKVVEI
YSAWTHYE
MRSDTVTIKNSAKVDLRKIKQSNLKKQFEEVIQALKEDPYMPTQSFEKLRPTHEGRYSRRLSRQHRVVYKVDEKNKVVEI
YSAWTHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|