Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 705650..706235 | Replicon | chromosome |
Accession | NZ_CP119393 | ||
Organism | Enterococcus casseliflavus strain ASE4 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | P0G38_RS03355 | Protein ID | WP_159160750.1 |
Coordinates | 705650..706015 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | P0G38_RS03360 | Protein ID | WP_159160751.1 |
Coordinates | 706005..706235 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0G38_RS03325 (P0G38_03325) | 700719..701018 | + | 300 | WP_034872120.1 | PTS sugar transporter subunit IIB | - |
P0G38_RS03330 (P0G38_03330) | 701020..701361 | + | 342 | WP_061053195.1 | PTS lactose/cellobiose transporter subunit IIA | - |
P0G38_RS03335 (P0G38_03335) | 701518..702852 | + | 1335 | WP_275854033.1 | hypothetical protein | - |
P0G38_RS03340 (P0G38_03340) | 702983..703201 | + | 219 | WP_275854034.1 | helix-turn-helix transcriptional regulator | - |
P0G38_RS03345 (P0G38_03345) | 703809..704582 | + | 774 | WP_275854035.1 | Fic family protein | - |
P0G38_RS03350 (P0G38_03350) | 704728..705393 | + | 666 | WP_252704509.1 | Fic family protein | - |
P0G38_RS03355 (P0G38_03355) | 705650..706015 | - | 366 | WP_159160750.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P0G38_RS03360 (P0G38_03360) | 706005..706235 | - | 231 | WP_159160751.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P0G38_RS03365 (P0G38_03365) | 706849..708213 | + | 1365 | WP_275854036.1 | guanine deaminase | - |
P0G38_RS03370 (P0G38_03370) | 708254..709574 | + | 1321 | Protein_631 | solute carrier family 23 protein | - |
P0G38_RS03375 (P0G38_03375) | 709593..710894 | - | 1302 | WP_275854037.1 | ISL3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 703809..716392 | 12583 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14141.18 Da Isoelectric Point: 9.6731
>T274051 WP_159160750.1 NZ_CP119393:c706015-705650 [Enterococcus casseliflavus]
MNYKPRQRDIVILDFEPSKGYEVRKRRPALVLSKDTYNSATNLIIVCPITTSDKERPFLVPIQSDKLKSNDSRPSKVNTL
QVFSLDYTQAANRNVKYIDTLDEEIFFDIAQRFLKNFSFPF
MNYKPRQRDIVILDFEPSKGYEVRKRRPALVLSKDTYNSATNLIIVCPITTSDKERPFLVPIQSDKLKSNDSRPSKVNTL
QVFSLDYTQAANRNVKYIDTLDEEIFFDIAQRFLKNFSFPF
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|