Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 1048558..1049242 | Replicon | chromosome |
Accession | NZ_CP119382 | ||
Organism | Pseudomonas kermanshahensis strain Mr36 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | PZ739_RS04685 | Protein ID | WP_275749295.1 |
Coordinates | 1048871..1049242 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | PZ739_RS04680 | Protein ID | WP_238210372.1 |
Coordinates | 1048558..1048878 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZ739_RS04655 (PZ739_04655) | 1044723..1045124 | + | 402 | WP_027595598.1 | hypothetical protein | - |
PZ739_RS04660 (PZ739_04660) | 1045117..1046493 | + | 1377 | WP_275749287.1 | class II fumarate hydratase | - |
PZ739_RS04665 (PZ739_04665) | 1046543..1047004 | + | 462 | WP_027595600.1 | hypothetical protein | - |
PZ739_RS04670 (PZ739_04670) | 1047006..1047617 | + | 612 | WP_275749290.1 | superoxide dismutase | - |
PZ739_RS04675 (PZ739_04675) | 1047629..1048522 | + | 894 | WP_275749292.1 | ZIP family metal transporter | - |
PZ739_RS04680 (PZ739_04680) | 1048558..1048878 | - | 321 | WP_238210372.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PZ739_RS04685 (PZ739_04685) | 1048871..1049242 | - | 372 | WP_275749295.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PZ739_RS04690 (PZ739_04690) | 1049330..1049602 | - | 273 | WP_027595603.1 | HPr family phosphocarrier protein | - |
PZ739_RS04695 (PZ739_04695) | 1049623..1050477 | - | 855 | WP_275749298.1 | RNase adapter RapZ | - |
PZ739_RS04700 (PZ739_04700) | 1050480..1050944 | - | 465 | WP_275749299.1 | PTS IIA-like nitrogen regulatory protein PtsN | - |
PZ739_RS04705 (PZ739_04705) | 1050957..1051265 | - | 309 | WP_003255135.1 | ribosome-associated translation inhibitor RaiA | - |
PZ739_RS04710 (PZ739_04710) | 1051345..1052838 | - | 1494 | WP_027595606.1 | RNA polymerase factor sigma-54 | - |
PZ739_RS04715 (PZ739_04715) | 1053014..1053739 | - | 726 | WP_027595607.1 | LPS export ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13508.46 Da Isoelectric Point: 9.1022
>T274048 WP_275749295.1 NZ_CP119382:c1049242-1048871 [Pseudomonas kermanshahensis]
MDAFKRVKPLYWVGSCKKDLQEAPSDVQDIFGFALHLAQEGGKHPQAKCLKGFTGAGVLEVVENHDSDTYRAIYTVSLGA
AVYVLHCFQKKSNSGIKTPKHDLDLVKSRLKQAVAHAKGTTHD
MDAFKRVKPLYWVGSCKKDLQEAPSDVQDIFGFALHLAQEGGKHPQAKCLKGFTGAGVLEVVENHDSDTYRAIYTVSLGA
AVYVLHCFQKKSNSGIKTPKHDLDLVKSRLKQAVAHAKGTTHD
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|