Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 6580491..6581105 | Replicon | chromosome |
| Accession | NZ_CP119371 | ||
| Organism | Pseudomonas sp. CBSPCAW29 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
| Locus tag | P0D95_RS30085 | Protein ID | WP_026077965.1 |
| Coordinates | 6580917..6581105 (-) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P0D95_RS30080 | Protein ID | WP_258347129.1 |
| Coordinates | 6580491..6580895 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D95_RS30055 (P0D95_30055) | 6575505..6576377 | + | 873 | WP_258347125.1 | urea transporter | - |
| P0D95_RS30060 (P0D95_30060) | 6576409..6577233 | + | 825 | WP_258347126.1 | ion transporter | - |
| P0D95_RS30065 (P0D95_30065) | 6577339..6578343 | + | 1005 | WP_258347127.1 | sulfate ABC transporter substrate-binding protein | - |
| P0D95_RS30070 (P0D95_30070) | 6578501..6579115 | - | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
| P0D95_RS30075 (P0D95_30075) | 6579294..6580490 | + | 1197 | WP_167663625.1 | MFS transporter | - |
| P0D95_RS30080 (P0D95_30080) | 6580491..6580895 | - | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P0D95_RS30085 (P0D95_30085) | 6580917..6581105 | - | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P0D95_RS30090 (P0D95_30090) | 6581321..6582199 | + | 879 | WP_258347130.1 | LysR family transcriptional regulator | - |
| P0D95_RS30095 (P0D95_30095) | 6582282..6583034 | - | 753 | WP_275845438.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
| P0D95_RS30100 (P0D95_30100) | 6583031..6583765 | - | 735 | WP_275845440.1 | zinc-dependent metalloprotease family protein | - |
| P0D95_RS30105 (P0D95_30105) | 6584112..6584861 | - | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
| P0D95_RS30110 (P0D95_30110) | 6584852..6585415 | - | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274045 WP_026077965.1 NZ_CP119371:c6581105-6580917 [Pseudomonas sp. CBSPCAW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274045 WP_258347129.1 NZ_CP119371:c6580895-6580491 [Pseudomonas sp. CBSPCAW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|