Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 876994..877510 | Replicon | chromosome |
Accession | NZ_CP119371 | ||
Organism | Pseudomonas sp. CBSPCAW29 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P0D95_RS04205 | Protein ID | WP_258342669.1 |
Coordinates | 876994..877281 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P0D95_RS04210 | Protein ID | WP_258348672.1 |
Coordinates | 877271..877510 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D95_RS04185 (P0D95_04185) | 872576..873523 | - | 948 | WP_177020250.1 | FecR family protein | - |
P0D95_RS04190 (P0D95_04190) | 873582..874055 | - | 474 | WP_275845531.1 | RNA polymerase sigma factor | - |
P0D95_RS04195 (P0D95_04195) | 874267..875325 | - | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
P0D95_RS04200 (P0D95_04200) | 875567..876958 | + | 1392 | WP_258342668.1 | L-cystine transporter | - |
P0D95_RS04205 (P0D95_04205) | 876994..877281 | - | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0D95_RS04210 (P0D95_04210) | 877271..877510 | - | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P0D95_RS04215 (P0D95_04215) | 877594..878082 | - | 489 | WP_275845630.1 | dihydrofolate reductase | - |
P0D95_RS04220 (P0D95_04220) | 878196..879575 | + | 1380 | WP_258342670.1 | DUF2868 domain-containing protein | - |
P0D95_RS04225 (P0D95_04225) | 879568..880941 | + | 1374 | WP_258342671.1 | DUF3482 domain-containing protein | - |
P0D95_RS04230 (P0D95_04230) | 880938..881492 | - | 555 | WP_258342672.1 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T274042 WP_258342669.1 NZ_CP119371:c877281-876994 [Pseudomonas sp. CBSPCAW29]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|