Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4275278..4275794 | Replicon | chromosome |
Accession | NZ_CP119370 | ||
Organism | Pseudomonas sp. CBSPCBW29 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P0D90_RS19890 | Protein ID | WP_258342669.1 |
Coordinates | 4275278..4275565 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P0D90_RS19895 | Protein ID | WP_258348672.1 |
Coordinates | 4275555..4275794 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D90_RS19865 (P0D90_19865) | 4270864..4271811 | - | 948 | WP_177020250.1 | FecR family protein | - |
P0D90_RS19870 (P0D90_19870) | 4271870..4272139 | - | 270 | WP_275712766.1 | sigma-70 family RNA polymerase sigma factor | - |
P0D90_RS19875 (P0D90_19875) | 4272187..4272246 | - | 60 | Protein_3930 | RNA polymerase subunit sigma | - |
P0D90_RS19880 (P0D90_19880) | 4272551..4273609 | - | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
P0D90_RS19885 (P0D90_19885) | 4273851..4275242 | + | 1392 | WP_258342668.1 | L-cystine transporter | - |
P0D90_RS19890 (P0D90_19890) | 4275278..4275565 | - | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0D90_RS19895 (P0D90_19895) | 4275555..4275794 | - | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P0D90_RS19900 (P0D90_19900) | 4275878..4276390 | - | 513 | WP_008438965.1 | dihydrofolate reductase | - |
P0D90_RS19905 (P0D90_19905) | 4276481..4277860 | + | 1380 | WP_258342670.1 | DUF2868 domain-containing protein | - |
P0D90_RS19910 (P0D90_19910) | 4277853..4279226 | + | 1374 | WP_258342671.1 | DUF3482 domain-containing protein | - |
P0D90_RS19915 (P0D90_19915) | 4279223..4279776 | - | 554 | Protein_3938 | HD domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T274040 WP_258342669.1 NZ_CP119370:c4275565-4275278 [Pseudomonas sp. CBSPCBW29]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|