Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2741573..2742187 | Replicon | chromosome |
Accession | NZ_CP119370 | ||
Organism | Pseudomonas sp. CBSPCBW29 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
Locus tag | P0D90_RS12375 | Protein ID | WP_026077965.1 |
Coordinates | 2741999..2742187 (-) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P0D90_RS12370 | Protein ID | WP_258347129.1 |
Coordinates | 2741573..2741977 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D90_RS12345 (P0D90_12345) | 2736589..2737461 | + | 873 | WP_258347125.1 | urea transporter | - |
P0D90_RS12350 (P0D90_12350) | 2737493..2738317 | + | 825 | WP_258347126.1 | ion transporter | - |
P0D90_RS12355 (P0D90_12355) | 2738423..2739427 | + | 1005 | WP_258347127.1 | sulfate ABC transporter substrate-binding protein | - |
P0D90_RS12360 (P0D90_12360) | 2739585..2740199 | - | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
P0D90_RS12365 (P0D90_12365) | 2740378..2741572 | + | 1195 | Protein_2452 | MFS transporter | - |
P0D90_RS12370 (P0D90_12370) | 2741573..2741977 | - | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P0D90_RS12375 (P0D90_12375) | 2741999..2742187 | - | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P0D90_RS12380 (P0D90_12380) | 2742403..2743281 | + | 879 | WP_258347130.1 | LysR family transcriptional regulator | - |
P0D90_RS12385 (P0D90_12385) | 2743364..2744848 | - | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
P0D90_RS12390 (P0D90_12390) | 2745195..2745944 | - | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
P0D90_RS12395 (P0D90_12395) | 2745935..2746498 | - | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274039 WP_026077965.1 NZ_CP119370:c2742187-2741999 [Pseudomonas sp. CBSPCBW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274039 WP_258347129.1 NZ_CP119370:c2741977-2741573 [Pseudomonas sp. CBSPCBW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|