Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3353363..3353977 | Replicon | chromosome |
Accession | NZ_CP119369 | ||
Organism | Pseudomonas sp. CBSPAW29 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
Locus tag | P0D92_RS15725 | Protein ID | WP_026077965.1 |
Coordinates | 3353363..3353551 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P0D92_RS15730 | Protein ID | WP_258347129.1 |
Coordinates | 3353573..3353977 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D92_RS15705 (P0D92_15705) | 3349053..3349616 | + | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
P0D92_RS15710 (P0D92_15710) | 3349607..3350356 | + | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
P0D92_RS15715 (P0D92_15715) | 3350703..3352187 | + | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
P0D92_RS15720 (P0D92_15720) | 3352270..3353147 | - | 878 | Protein_3091 | LysR family transcriptional regulator | - |
P0D92_RS15725 (P0D92_15725) | 3353363..3353551 | + | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P0D92_RS15730 (P0D92_15730) | 3353573..3353977 | + | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P0D92_RS15735 (P0D92_15735) | 3353978..3355174 | - | 1197 | WP_167663625.1 | MFS transporter | - |
P0D92_RS15740 (P0D92_15740) | 3355353..3355967 | + | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
P0D92_RS15745 (P0D92_15745) | 3356125..3357128 | - | 1004 | Protein_3096 | sulfate ABC transporter substrate-binding protein | - |
P0D92_RS15750 (P0D92_15750) | 3357234..3358058 | - | 825 | WP_258347126.1 | ion transporter | - |
P0D92_RS15755 (P0D92_15755) | 3358090..3358962 | - | 873 | WP_258347125.1 | urea transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274035 WP_026077965.1 NZ_CP119369:3353363-3353551 [Pseudomonas sp. CBSPAW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274035 WP_258347129.1 NZ_CP119369:3353573-3353977 [Pseudomonas sp. CBSPAW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|