Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1819751..1820267 | Replicon | chromosome |
Accession | NZ_CP119369 | ||
Organism | Pseudomonas sp. CBSPAW29 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P0D92_RS08195 | Protein ID | WP_258342669.1 |
Coordinates | 1819980..1820267 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P0D92_RS08190 | Protein ID | WP_258348672.1 |
Coordinates | 1819751..1819990 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D92_RS08170 (P0D92_08170) | 1815769..1816323 | + | 555 | WP_258342672.1 | HD domain-containing protein | - |
P0D92_RS08175 (P0D92_08175) | 1816320..1817693 | - | 1374 | WP_258342671.1 | DUF3482 domain-containing protein | - |
P0D92_RS08180 (P0D92_08180) | 1817686..1819064 | - | 1379 | Protein_1607 | DUF2868 domain-containing protein | - |
P0D92_RS08185 (P0D92_08185) | 1819155..1819667 | + | 513 | WP_008438965.1 | dihydrofolate reductase | - |
P0D92_RS08190 (P0D92_08190) | 1819751..1819990 | + | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P0D92_RS08195 (P0D92_08195) | 1819980..1820267 | + | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P0D92_RS08200 (P0D92_08200) | 1820303..1821693 | - | 1391 | Protein_1611 | L-cystine transporter | - |
P0D92_RS08205 (P0D92_08205) | 1821935..1822993 | + | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
P0D92_RS08210 (P0D92_08210) | 1823205..1823738 | + | 534 | WP_177020251.1 | RNA polymerase sigma factor | - |
P0D92_RS08215 (P0D92_08215) | 1823735..1824682 | + | 948 | WP_177020250.1 | FecR family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | algC / algC / algR / pilT / pilG / pilH / pilI / pilJ | 1601604..1899809 | 298205 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T274034 WP_258342669.1 NZ_CP119369:1819980-1820267 [Pseudomonas sp. CBSPAW29]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|