Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 2005803..2006417 | Replicon | chromosome |
Accession | NZ_CP119368 | ||
Organism | Pseudomonas sp. CBSPCGW29 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
Locus tag | P0D94_RS09720 | Protein ID | WP_026077965.1 |
Coordinates | 2005803..2005991 (+) | Length | 63 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P0D94_RS09725 | Protein ID | WP_258347129.1 |
Coordinates | 2006013..2006417 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0D94_RS09700 (P0D94_09700) | 2001494..2002057 | + | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
P0D94_RS09705 (P0D94_09705) | 2002048..2002857 | + | 810 | WP_275711789.1 | phosphonate metabolism protein PhnP | - |
P0D94_RS09710 (P0D94_09710) | 2003142..2004626 | + | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
P0D94_RS09715 (P0D94_09715) | 2004709..2005587 | - | 879 | WP_258347130.1 | LysR family transcriptional regulator | - |
P0D94_RS09720 (P0D94_09720) | 2005803..2005991 | + | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P0D94_RS09725 (P0D94_09725) | 2006013..2006417 | + | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P0D94_RS09730 (P0D94_09730) | 2006418..2007614 | - | 1197 | WP_167663625.1 | MFS transporter | - |
P0D94_RS09735 (P0D94_09735) | 2007793..2008407 | + | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
P0D94_RS09740 (P0D94_09740) | 2008565..2009568 | - | 1004 | Protein_1922 | sulfate ABC transporter substrate-binding protein | - |
P0D94_RS09745 (P0D94_09745) | 2009674..2010498 | - | 825 | WP_258347126.1 | ion transporter | - |
P0D94_RS09750 (P0D94_09750) | 2010530..2011402 | - | 873 | WP_258347125.1 | urea transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274031 WP_026077965.1 NZ_CP119368:2005803-2005991 [Pseudomonas sp. CBSPCGW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274031 WP_258347129.1 NZ_CP119368:2006013-2006417 [Pseudomonas sp. CBSPCGW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|