Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 472038..472554 | Replicon | chromosome |
| Accession | NZ_CP119368 | ||
| Organism | Pseudomonas sp. CBSPCGW29 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P0D94_RS02215 | Protein ID | WP_258342669.1 |
| Coordinates | 472267..472554 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P0D94_RS02210 | Protein ID | WP_258348672.1 |
| Coordinates | 472038..472277 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D94_RS02190 (P0D94_02190) | 468056..468610 | + | 555 | WP_258342672.1 | HD domain-containing protein | - |
| P0D94_RS02195 (P0D94_02195) | 468607..469979 | - | 1373 | Protein_437 | DUF3482 domain-containing protein | - |
| P0D94_RS02200 (P0D94_02200) | 469972..471351 | - | 1380 | WP_258342670.1 | DUF2868 domain-containing protein | - |
| P0D94_RS02205 (P0D94_02205) | 471442..471954 | + | 513 | WP_008438965.1 | dihydrofolate reductase | - |
| P0D94_RS02210 (P0D94_02210) | 472038..472277 | + | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P0D94_RS02215 (P0D94_02215) | 472267..472554 | + | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0D94_RS02220 (P0D94_02220) | 472590..473981 | - | 1392 | WP_258342668.1 | L-cystine transporter | - |
| P0D94_RS02225 (P0D94_02225) | 474223..475281 | + | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
| P0D94_RS02230 (P0D94_02230) | 475493..476026 | + | 534 | WP_177020251.1 | RNA polymerase sigma factor | - |
| P0D94_RS02235 (P0D94_02235) | 476023..476970 | + | 948 | WP_177020250.1 | FecR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T274030 WP_258342669.1 NZ_CP119368:472267-472554 [Pseudomonas sp. CBSPCGW29]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|