Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5083268..5083882 | Replicon | chromosome |
| Accession | NZ_CP119367 | ||
| Organism | Pseudomonas sp. CBSPGW29 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
| Locus tag | P0D93_RS23780 | Protein ID | WP_026077965.1 |
| Coordinates | 5083268..5083456 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P0D93_RS23785 | Protein ID | WP_258347129.1 |
| Coordinates | 5083478..5083882 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D93_RS23760 (P0D93_23760) | 5078958..5079521 | + | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
| P0D93_RS23765 (P0D93_23765) | 5079512..5080261 | + | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
| P0D93_RS23770 (P0D93_23770) | 5080608..5082092 | + | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
| P0D93_RS23775 (P0D93_23775) | 5082175..5083052 | - | 878 | Protein_4688 | LysR family transcriptional regulator | - |
| P0D93_RS23780 (P0D93_23780) | 5083268..5083456 | + | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P0D93_RS23785 (P0D93_23785) | 5083478..5083882 | + | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P0D93_RS23790 (P0D93_23790) | 5083883..5085079 | - | 1197 | WP_167663625.1 | MFS transporter | - |
| P0D93_RS23795 (P0D93_23795) | 5085258..5085872 | + | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
| P0D93_RS23800 (P0D93_23800) | 5086030..5087031 | - | 1002 | Protein_4693 | sulfate ABC transporter substrate-binding protein | - |
| P0D93_RS23805 (P0D93_23805) | 5087137..5087961 | - | 825 | WP_258347126.1 | ion transporter | - |
| P0D93_RS23810 (P0D93_23810) | 5087993..5088864 | - | 872 | Protein_4695 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274028 WP_026077965.1 NZ_CP119367:5083268-5083456 [Pseudomonas sp. CBSPGW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274028 WP_258347129.1 NZ_CP119367:5083478-5083882 [Pseudomonas sp. CBSPGW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|