Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 6354187..6354801 | Replicon | chromosome |
| Accession | NZ_CP119366 | ||
| Organism | Pseudomonas sp. CBSPBW29 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1R0GDL0 |
| Locus tag | P0D91_RS29610 | Protein ID | WP_026077965.1 |
| Coordinates | 6354187..6354375 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P0D91_RS29615 | Protein ID | WP_258347129.1 |
| Coordinates | 6354397..6354801 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D91_RS29590 (P0D91_29590) | 6349877..6350440 | + | 564 | WP_258347133.1 | phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | - |
| P0D91_RS29595 (P0D91_29595) | 6350431..6351180 | + | 750 | WP_258347132.1 | phosphonate metabolism protein PhnP | - |
| P0D91_RS29600 (P0D91_29600) | 6351527..6353011 | + | 1485 | WP_258347131.1 | M10 family metallopeptidase C-terminal domain-containing protein | - |
| P0D91_RS29605 (P0D91_29605) | 6353094..6353971 | - | 878 | Protein_5852 | LysR family transcriptional regulator | - |
| P0D91_RS29610 (P0D91_29610) | 6354187..6354375 | + | 189 | WP_026077965.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P0D91_RS29615 (P0D91_29615) | 6354397..6354801 | + | 405 | WP_258347129.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P0D91_RS29620 (P0D91_29620) | 6354802..6355998 | - | 1197 | WP_167663625.1 | MFS transporter | - |
| P0D91_RS29625 (P0D91_29625) | 6356177..6356791 | + | 615 | WP_258347128.1 | DUF5666 domain-containing protein | - |
| P0D91_RS29630 (P0D91_29630) | 6356949..6357952 | - | 1004 | Protein_5857 | sulfate ABC transporter substrate-binding protein | - |
| P0D91_RS29635 (P0D91_29635) | 6358058..6358882 | - | 825 | WP_258347126.1 | ion transporter | - |
| P0D91_RS29640 (P0D91_29640) | 6358914..6359786 | - | 873 | WP_258347125.1 | urea transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7196.40 Da Isoelectric Point: 11.2000
>T274024 WP_026077965.1 NZ_CP119366:6354187-6354375 [Pseudomonas sp. CBSPBW29]
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
VQSRLLIKELQEAGWVLDRVTGSHHLFTHRYNPYTIPVPHPKKDLPMGTVRSIRKRAGLFSF
Download Length: 189 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14776.83 Da Isoelectric Point: 4.5011
>AT274024 WP_258347129.1 NZ_CP119366:6354397-6354801 [Pseudomonas sp. CBSPBW29]
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
MQYPICIEWGDDFVATGIQIPDIPGAVTAGDSFEEAYNAAVEVAHIMLQEIAAEGRAIPMPTSVAAHHDNEDYAGMGWGM
LELDISPYLGKTEKVNVTLPGYVIQRIDRYVREHKVKSRSSFLADAALEKLVRL
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|