Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4820210..4820726 | Replicon | chromosome |
| Accession | NZ_CP119366 | ||
| Organism | Pseudomonas sp. CBSPBW29 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P0D91_RS22105 | Protein ID | WP_258342669.1 |
| Coordinates | 4820439..4820726 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P0D91_RS22100 | Protein ID | WP_258348672.1 |
| Coordinates | 4820210..4820449 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P0D91_RS22080 (P0D91_22080) | 4816227..4816781 | + | 555 | WP_258342672.1 | HD domain-containing protein | - |
| P0D91_RS22085 (P0D91_22085) | 4816778..4818151 | - | 1374 | WP_258342671.1 | DUF3482 domain-containing protein | - |
| P0D91_RS22090 (P0D91_22090) | 4818144..4819523 | - | 1380 | WP_258342670.1 | DUF2868 domain-containing protein | - |
| P0D91_RS22095 (P0D91_22095) | 4819614..4820126 | + | 513 | WP_008438965.1 | dihydrofolate reductase | - |
| P0D91_RS22100 (P0D91_22100) | 4820210..4820449 | + | 240 | WP_258348672.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P0D91_RS22105 (P0D91_22105) | 4820439..4820726 | + | 288 | WP_258342669.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P0D91_RS22110 (P0D91_22110) | 4820762..4822153 | - | 1392 | WP_258342668.1 | L-cystine transporter | - |
| P0D91_RS22115 (P0D91_22115) | 4822395..4823453 | + | 1059 | WP_256344485.1 | haloacid dehalogenase-like hydrolase | - |
| P0D91_RS22120 (P0D91_22120) | 4823665..4824198 | + | 534 | WP_177020251.1 | RNA polymerase sigma factor | - |
| P0D91_RS22125 (P0D91_22125) | 4824195..4825142 | + | 948 | WP_177020250.1 | FecR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11365.24 Da Isoelectric Point: 10.0977
>T274023 WP_258342669.1 NZ_CP119366:4820439-4820726 [Pseudomonas sp. CBSPBW29]
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
MTYNLEFDARALKEWRKLGDTVRQQLKKKLVEILTHPRIEANRLHGLPDCYKIKLRSSGYRLVYQVIDQEVMVFVVAVDK
RERDEVYRKATERLS
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|