Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2124963..2125492 | Replicon | chromosome |
| Accession | NZ_CP119344 | ||
| Organism | Staphylococcus aureus strain N29CSA11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | P1A16_RS10495 | Protein ID | WP_000621175.1 |
| Coordinates | 2124963..2125325 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | P1A16_RS10500 | Protein ID | WP_000948331.1 |
| Coordinates | 2125322..2125492 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A16_RS10475 (P1A16_10475) | 2121941..2122711 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| P1A16_RS10480 (P1A16_10480) | 2122686..2123165 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| P1A16_RS10485 (P1A16_10485) | 2123167..2123493 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| P1A16_RS10490 (P1A16_10490) | 2123612..2124613 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| P1A16_RS10495 (P1A16_10495) | 2124963..2125325 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P1A16_RS10500 (P1A16_10500) | 2125322..2125492 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| P1A16_RS10505 (P1A16_10505) | 2125577..2126725 | - | 1149 | WP_113342708.1 | alanine racemase | - |
| P1A16_RS10510 (P1A16_10510) | 2126791..2127150 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| P1A16_RS10515 (P1A16_10515) | 2127154..2127645 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
| P1A16_RS10520 (P1A16_10520) | 2127632..2129215 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| P1A16_RS10525 (P1A16_10525) | 2129208..2129687 | - | 480 | WP_031590204.1 | hypothetical protein | - |
| P1A16_RS10530 (P1A16_10530) | 2129896..2130456 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T274016 WP_000621175.1 NZ_CP119344:c2125325-2124963 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|