Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 923134..923611 Replicon chromosome
Accession NZ_CP119344
Organism Staphylococcus aureus strain N29CSA11

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag P1A16_RS04510 Protein ID WP_000052076.1
Coordinates 923134..923322 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag P1A16_RS04515 Protein ID WP_001059690.1
Coordinates 923351..923611 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A16_RS04480 (P1A16_04480) 919169..919645 + 477 WP_000824477.1 hypothetical protein -
P1A16_RS04485 (P1A16_04485) 919986..920672 + 687 WP_001641381.1 thermonuclease family protein -
P1A16_RS04490 (P1A16_04490) 921029..921229 + 201 WP_001059082.1 cold-shock protein -
P1A16_RS04495 (P1A16_04495) 921725..921943 - 219 WP_000005887.1 hypothetical protein -
P1A16_RS04500 (P1A16_04500) 922005..922289 - 285 WP_031590186.1 hypothetical protein -
P1A16_RS04505 (P1A16_04505) 922377..922946 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
P1A16_RS04510 (P1A16_04510) 923134..923322 - 189 WP_000052076.1 hypothetical protein Toxin
P1A16_RS04515 (P1A16_04515) 923351..923611 - 261 WP_001059690.1 hypothetical protein Antitoxin
P1A16_RS04520 (P1A16_04520) 923952..924155 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
P1A16_RS04525 (P1A16_04525) 924152..924388 - 237 WP_000368687.1 hypothetical protein -
P1A16_RS04530 (P1A16_04530) 924613..925194 + 582 WP_001140697.1 histidine phosphatase family protein -
P1A16_RS04535 (P1A16_04535) 925267..925884 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
P1A16_RS04540 (P1A16_04540) 926040..926534 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
P1A16_RS04545 (P1A16_04545) 926932..927354 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
P1A16_RS04550 (P1A16_04550) 927502..928218 + 717 WP_031589686.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T274013 WP_000052076.1 NZ_CP119344:c923322-923134 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT274013 WP_001059690.1 NZ_CP119344:c923611-923351 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References