Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2182035..2182564 | Replicon | chromosome |
Accession | NZ_CP119341 | ||
Organism | Staphylococcus aureus strain N29CSA02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | P1A17_RS10900 | Protein ID | WP_000621175.1 |
Coordinates | 2182035..2182397 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | P1A17_RS10905 | Protein ID | WP_000948331.1 |
Coordinates | 2182394..2182564 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1A17_RS10880 (2178990) | 2178990..2179760 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
P1A17_RS10885 (2179735) | 2179735..2180214 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
P1A17_RS10890 (2180216) | 2180216..2180542 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
P1A17_RS10895 (2180661) | 2180661..2181662 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
P1A17_RS10900 (2182035) | 2182035..2182397 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P1A17_RS10905 (2182394) | 2182394..2182564 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P1A17_RS10910 (2182649) | 2182649..2183797 | - | 1149 | WP_001281154.1 | alanine racemase | - |
P1A17_RS10915 (2183863) | 2183863..2184222 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
P1A17_RS10920 (2184226) | 2184226..2184717 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
P1A17_RS10925 (2184704) | 2184704..2186287 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
P1A17_RS10930 (2186280) | 2186280..2186759 | - | 480 | WP_031590204.1 | hypothetical protein | - |
P1A17_RS10935 (2186968) | 2186968..2187528 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T274007 WP_000621175.1 NZ_CP119341:c2182397-2182035 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|