Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2115152..2115949 Replicon chromosome
Accession NZ_CP119341
Organism Staphylococcus aureus strain N29CSA02

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag P1A17_RS10560 Protein ID WP_000525014.1
Coordinates 2115488..2115949 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag P1A17_RS10555 Protein ID WP_001260487.1
Coordinates 2115152..2115475 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A17_RS10485 (2110211) 2110211..2110969 - 759 WP_001003951.1 DUF1351 domain-containing protein -
P1A17_RS10490 (2110980) 2110980..2111303 - 324 WP_000171560.1 hypothetical protein -
P1A17_RS10495 (2111316) 2111316..2111927 - 612 WP_001105358.1 MBL fold metallo-hydrolase -
P1A17_RS10500 (2111950) 2111950..2112186 - 237 WP_000802314.1 hypothetical protein -
P1A17_RS10505 (2112194) 2112194..2112454 - 261 WP_000291082.1 DUF1108 family protein -
P1A17_RS10510 (2112553) 2112553..2112714 - 162 WP_001285953.1 DUF1270 family protein -
P1A17_RS10515 (2112711) 2112711..2113031 - 321 WP_001120202.1 DUF771 domain-containing protein -
P1A17_RS10520 (2113182) 2113182..2113325 - 144 WP_000939498.1 hypothetical protein -
P1A17_RS10525 (2113392) 2113392..2113614 + 223 Protein_2037 hypothetical protein -
P1A17_RS10530 (2113601) 2113601..2113798 - 198 WP_031838117.1 hypothetical protein -
P1A17_RS10535 (2113867) 2113867..2114079 + 213 WP_000362645.1 hypothetical protein -
P1A17_RS10540 (2114120) 2114120..2114269 - 150 WP_000771849.1 hypothetical protein -
P1A17_RS10545 (2114284) 2114284..2114727 - 444 WP_000435352.1 hypothetical protein -
P1A17_RS10550 (2114740) 2114740..2114988 - 249 WP_000272856.1 helix-turn-helix transcriptional regulator -
P1A17_RS10555 (2115152) 2115152..2115475 + 324 WP_001260487.1 helix-turn-helix transcriptional regulator Antitoxin
P1A17_RS10560 (2115488) 2115488..2115949 + 462 WP_000525014.1 hypothetical protein Toxin
P1A17_RS10565 (2115966) 2115966..2116412 + 447 WP_001226135.1 hypothetical protein -
P1A17_RS10570 (2116445) 2116445..2117365 + 921 WP_224679035.1 hypothetical protein -
P1A17_RS10575 (2117686) 2117686..2118039 + 354 WP_215344724.1 hypothetical protein -
P1A17_RS10580 (2118138) 2118138..2118305 + 168 WP_001166555.1 hypothetical protein -
P1A17_RS10585 (2118645) 2118645..2119010 + 366 WP_000440839.1 type II toxin-antitoxin system PemK/MazF family toxin -
P1A17_RS10590 (2119056) 2119056..2119349 + 294 WP_224397069.1 hypothetical protein -
P1A17_RS10595 (2119511) 2119511..2120548 + 1038 WP_000857172.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - hlb / groEL 2077359..2134708 57349


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18104.44 Da        Isoelectric Point: 4.6915

>T274006 WP_000525014.1 NZ_CP119341:2115488-2115949 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVYRYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT274006 WP_001260487.1 NZ_CP119341:2115152-2115475 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References