Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 2115152..2115949 | Replicon | chromosome |
| Accession | NZ_CP119341 | ||
| Organism | Staphylococcus aureus strain N29CSA02 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | P1A17_RS10560 | Protein ID | WP_000525014.1 |
| Coordinates | 2115488..2115949 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0C2LD36 |
| Locus tag | P1A17_RS10555 | Protein ID | WP_001260487.1 |
| Coordinates | 2115152..2115475 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A17_RS10485 (2110211) | 2110211..2110969 | - | 759 | WP_001003951.1 | DUF1351 domain-containing protein | - |
| P1A17_RS10490 (2110980) | 2110980..2111303 | - | 324 | WP_000171560.1 | hypothetical protein | - |
| P1A17_RS10495 (2111316) | 2111316..2111927 | - | 612 | WP_001105358.1 | MBL fold metallo-hydrolase | - |
| P1A17_RS10500 (2111950) | 2111950..2112186 | - | 237 | WP_000802314.1 | hypothetical protein | - |
| P1A17_RS10505 (2112194) | 2112194..2112454 | - | 261 | WP_000291082.1 | DUF1108 family protein | - |
| P1A17_RS10510 (2112553) | 2112553..2112714 | - | 162 | WP_001285953.1 | DUF1270 family protein | - |
| P1A17_RS10515 (2112711) | 2112711..2113031 | - | 321 | WP_001120202.1 | DUF771 domain-containing protein | - |
| P1A17_RS10520 (2113182) | 2113182..2113325 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| P1A17_RS10525 (2113392) | 2113392..2113614 | + | 223 | Protein_2037 | hypothetical protein | - |
| P1A17_RS10530 (2113601) | 2113601..2113798 | - | 198 | WP_031838117.1 | hypothetical protein | - |
| P1A17_RS10535 (2113867) | 2113867..2114079 | + | 213 | WP_000362645.1 | hypothetical protein | - |
| P1A17_RS10540 (2114120) | 2114120..2114269 | - | 150 | WP_000771849.1 | hypothetical protein | - |
| P1A17_RS10545 (2114284) | 2114284..2114727 | - | 444 | WP_000435352.1 | hypothetical protein | - |
| P1A17_RS10550 (2114740) | 2114740..2114988 | - | 249 | WP_000272856.1 | helix-turn-helix transcriptional regulator | - |
| P1A17_RS10555 (2115152) | 2115152..2115475 | + | 324 | WP_001260487.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P1A17_RS10560 (2115488) | 2115488..2115949 | + | 462 | WP_000525014.1 | hypothetical protein | Toxin |
| P1A17_RS10565 (2115966) | 2115966..2116412 | + | 447 | WP_001226135.1 | hypothetical protein | - |
| P1A17_RS10570 (2116445) | 2116445..2117365 | + | 921 | WP_224679035.1 | hypothetical protein | - |
| P1A17_RS10575 (2117686) | 2117686..2118039 | + | 354 | WP_215344724.1 | hypothetical protein | - |
| P1A17_RS10580 (2118138) | 2118138..2118305 | + | 168 | WP_001166555.1 | hypothetical protein | - |
| P1A17_RS10585 (2118645) | 2118645..2119010 | + | 366 | WP_000440839.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| P1A17_RS10590 (2119056) | 2119056..2119349 | + | 294 | WP_224397069.1 | hypothetical protein | - |
| P1A17_RS10595 (2119511) | 2119511..2120548 | + | 1038 | WP_000857172.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlb / groEL | 2077359..2134708 | 57349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18104.44 Da Isoelectric Point: 4.6915
>T274006 WP_000525014.1 NZ_CP119341:2115488-2115949 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVYRYKEI
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVYRYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|