Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1969115..1969891 | Replicon | chromosome |
| Accession | NZ_CP119341 | ||
| Organism | Staphylococcus aureus strain N29CSA02 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | X5E2E6 |
| Locus tag | P1A17_RS09595 | Protein ID | WP_000031108.1 |
| Coordinates | 1969115..1969267 (-) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | - |
| Locus tag | P1A17_RS09600 | Protein ID | WP_001251230.1 |
| Coordinates | 1969292..1969891 (-) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A17_RS09580 (1965030) | 1965030..1965851 | + | 822 | WP_000669376.1 | RluA family pseudouridine synthase | - |
| P1A17_RS09585 (1966303) | 1966303..1967688 | - | 1386 | WP_000116229.1 | class II fumarate hydratase | - |
| P1A17_RS09590 (1967884) | 1967884..1968279 | - | 396 | WP_000901023.1 | hypothetical protein | - |
| P1A17_RS09595 (1969115) | 1969115..1969267 | - | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
| P1A17_RS09600 (1969292) | 1969292..1969891 | - | 600 | WP_001251230.1 | hypothetical protein | Antitoxin |
| P1A17_RS09605 (1970050) | 1970050..1970520 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| P1A17_RS09610 (1970525) | 1970525..1971652 | - | 1128 | WP_031590038.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| P1A17_RS09615 (1971803) | 1971803..1972525 | - | 723 | WP_000590809.1 | amino acid ABC transporter ATP-binding protein | - |
| P1A17_RS09620 (1972518) | 1972518..1973975 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T274000 WP_000031108.1 NZ_CP119341:c1969267-1969115 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22369.51 Da Isoelectric Point: 4.9728
>AT274000 WP_001251230.1 NZ_CP119341:c1969891-1969292 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKYAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|