Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 917391..917868 Replicon chromosome
Accession NZ_CP119341
Organism Staphylococcus aureus strain N29CSA02

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag P1A17_RS04495 Protein ID WP_000052076.1
Coordinates 917391..917579 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag P1A17_RS04500 Protein ID WP_001059690.1
Coordinates 917608..917868 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P1A17_RS04465 (913426) 913426..913902 + 477 WP_000824477.1 hypothetical protein -
P1A17_RS04470 (914243) 914243..914929 + 687 WP_001641381.1 thermonuclease family protein -
P1A17_RS04475 (915286) 915286..915486 + 201 WP_001059082.1 cold-shock protein -
P1A17_RS04480 (915982) 915982..916200 - 219 WP_000005887.1 hypothetical protein -
P1A17_RS04485 (916262) 916262..916546 - 285 WP_031590186.1 hypothetical protein -
P1A17_RS04490 (916634) 916634..917203 - 570 WP_001106652.1 lipoprotein N-acylation protein LnsA -
P1A17_RS04495 (917391) 917391..917579 - 189 WP_000052076.1 hypothetical protein Toxin
P1A17_RS04500 (917608) 917608..917868 - 261 WP_001059690.1 hypothetical protein Antitoxin
P1A17_RS04505 (918209) 918209..918412 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
P1A17_RS04510 (918409) 918409..918645 - 237 WP_000368687.1 hypothetical protein -
P1A17_RS04515 (918870) 918870..919451 + 582 WP_001140697.1 histidine phosphatase family protein -
P1A17_RS04520 (919524) 919524..920141 - 618 WP_000255553.1 LysE/ArgO family amino acid transporter -
P1A17_RS04525 (920297) 920297..920791 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
P1A17_RS04530 (921190) 921190..921612 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
P1A17_RS04535 (921760) 921760..922476 + 717 WP_031589686.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T273998 WP_000052076.1 NZ_CP119341:c917579-917391 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT273998 WP_001059690.1 NZ_CP119341:c917868-917608 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References