Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2155025..2155554 | Replicon | chromosome |
| Accession | NZ_CP119340 | ||
| Organism | Staphylococcus aureus strain N28CSA05 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | P1A15_RS10650 | Protein ID | WP_000621175.1 |
| Coordinates | 2155025..2155387 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | P1A15_RS10655 | Protein ID | WP_000948331.1 |
| Coordinates | 2155384..2155554 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1A15_RS10630 (P1A15_10630) | 2152003..2152773 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
| P1A15_RS10635 (P1A15_10635) | 2152748..2153227 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| P1A15_RS10640 (P1A15_10640) | 2153229..2153555 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| P1A15_RS10645 (P1A15_10645) | 2153674..2154675 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| P1A15_RS10650 (P1A15_10650) | 2155025..2155387 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P1A15_RS10655 (P1A15_10655) | 2155384..2155554 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| P1A15_RS10660 (P1A15_10660) | 2155639..2156787 | - | 1149 | WP_113342708.1 | alanine racemase | - |
| P1A15_RS10665 (P1A15_10665) | 2156853..2157212 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| P1A15_RS10670 (P1A15_10670) | 2157216..2157707 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
| P1A15_RS10675 (P1A15_10675) | 2157694..2159277 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
| P1A15_RS10680 (P1A15_10680) | 2159270..2159749 | - | 480 | WP_031590204.1 | hypothetical protein | - |
| P1A15_RS10685 (P1A15_10685) | 2159958..2160518 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273992 WP_000621175.1 NZ_CP119340:c2155387-2155025 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|