Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2150579..2151108 | Replicon | chromosome |
Accession | NZ_CP119338 | ||
Organism | Staphylococcus aureus strain N09HSA11 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | P1A14_RS10625 | Protein ID | WP_000621175.1 |
Coordinates | 2150579..2150941 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | P1A14_RS10630 | Protein ID | WP_000948331.1 |
Coordinates | 2150938..2151108 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1A14_RS10605 (P1A14_10605) | 2147557..2148327 | - | 771 | WP_001041102.1 | RNA polymerase sigma factor SigB | - |
P1A14_RS10610 (P1A14_10610) | 2148302..2148781 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
P1A14_RS10615 (P1A14_10615) | 2148783..2149109 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
P1A14_RS10620 (P1A14_10620) | 2149228..2150229 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
P1A14_RS10625 (P1A14_10625) | 2150579..2150941 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P1A14_RS10630 (P1A14_10630) | 2150938..2151108 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P1A14_RS10635 (P1A14_10635) | 2151193..2152341 | - | 1149 | WP_001281154.1 | alanine racemase | - |
P1A14_RS10640 (P1A14_10640) | 2152407..2152766 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
P1A14_RS10645 (P1A14_10645) | 2152770..2153261 | - | 492 | WP_072353916.1 | PH domain-containing protein | - |
P1A14_RS10650 (P1A14_10650) | 2153248..2154831 | - | 1584 | WP_001294626.1 | PH domain-containing protein | - |
P1A14_RS10655 (P1A14_10655) | 2154824..2155303 | - | 480 | WP_031590204.1 | hypothetical protein | - |
P1A14_RS10660 (P1A14_10660) | 2155512..2156072 | - | 561 | WP_001092410.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273983 WP_000621175.1 NZ_CP119338:c2150941-2150579 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|